KEGG   Solanum lycopersicum (tomato): 778285Help
Entry
778285            CDS       T02665                                 

Gene name
mMDH
Definition
mitochondrial malate dehydrogenase (EC:1.1.1.37)
Orthology
K00026  
malate dehydrogenase [EC:1.1.1.37]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Class
Metabolism; Overview; Carbon metabolism [PATH:sly01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sly00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sly00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sly00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:sly00710]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sly00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 346 aa AA seqDB search
MRTSMLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVS
SLSLYDIAGTPGVAADVSHINTRSEVAGFAGEEQLGQALEGADVVIIPAGVPRKPGMTRD
DLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTM
LDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGITILPLFSQATPKANLSYEEIVALTKRTQ
DGGTEVVEAKAGKGSXTLSIAYAGAIFADACLKGLNGVPDVVECAFVQSNVTELPFFASK
VRLGKNGVEEVLGLGPLNDYEKQGLEALKPELLSSIEKGIKFAKEN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaggacctccatgttgaaatccatcgtccgccggagctccactgccggagcatcctat
gtatctcgccgtggattcgcatcgggatccgcgccggagaggaaagttgcagttttgggg
gcagccggagggattggacagcctttatctcttctaatgaagcttaaccctttagtatcc
agcctttcactctacgatatcgccggtactcccggtgttgccgccgatgttagtcacatc
aacaccagatctgaggttgccggttttgcaggagaagagcagctagggcaggcactggaa
ggagctgatgttgttatcattcctgctggtgtgccccgaaagcctggtatgacccgagat
gatctgttcaacattaatgcgggtattgttaaatctctatgcacggccattgctaagtac
tgccccaatgctctggtcaatatgataagcaacccagtgaattccactgtccctattgct
gctgaggtgtttaagaaagctggaacttatgatgaaaagaagctctttggagttaccatg
cttgatgtggttagggccaagacattttatgctggaaaagctaaagtaaatgttgctgag
gtcaatctcccagtagttggtggtcatgctggcataactatcctcccattattttctcaa
gccactccaaaggcaaatctatcatatgaggaaattgttgcactcacaaagcgaacccaa
gatggtgggacagaagttgtagaagccaaagctggaaagggttcanccaccctctcaata
gcctatgctggggctatttttgccgatgcttgcttgaaggggttgaatggagttcccgat
gttgttgaatgtgcttttgtgcagtccaatgtcaccgagcttcccttcttcgcatccaag
gtaagacttgggaaaaatggagtggaggaagtcctagggttgggtccacttaacgactac
gagaagcaaggacttgaggctcttaagccagagctgctctcctccattgaaaagggaatc
aagtttgccaaagaaaactaa

DBGET integrated database retrieval system