KEGG   Solanum lycopersicum (tomato): 778285Help
Entry
778285            CDS       T02665                                 

Gene name
mMDH
Definition
mitochondrial malate dehydrogenase (EC:1.1.1.37)
Orthology
K00026  
malate dehydrogenase [EC:1.1.1.37]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    778285 (mMDH)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    778285 (mMDH)
   00620 Pyruvate metabolism
    778285 (mMDH)
   00630 Glyoxylate and dicarboxylate metabolism
    778285 (mMDH)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    778285 (mMDH)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    778285 (mMDH)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     778285 (mMDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 346 aa AA seqDB search
MRTSMLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVS
SLSLYDIAGTPGVAADVSHINTRSEVAGFAGEEQLGQALEGADVVIIPAGVPRKPGMTRD
DLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTM
LDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGITILPLFSQATPKANLSYEEIVALTKRTQ
DGGTEVVEAKAGKGSXTLSIAYAGAIFADACLKGLNGVPDVVECAFVQSNVTELPFFASK
VRLGKNGVEEVLGLGPLNDYEKQGLEALKPELLSSIEKGIKFAKEN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaggacctccatgttgaaatccatcgtccgccggagctccactgccggagcatcctat
gtatctcgccgtggattcgcatcgggatccgcgccggagaggaaagttgcagttttgggg
gcagccggagggattggacagcctttatctcttctaatgaagcttaaccctttagtatcc
agcctttcactctacgatatcgccggtactcccggtgttgccgccgatgttagtcacatc
aacaccagatctgaggttgccggttttgcaggagaagagcagctagggcaggcactggaa
ggagctgatgttgttatcattcctgctggtgtgccccgaaagcctggtatgacccgagat
gatctgttcaacattaatgcgggtattgttaaatctctatgcacggccattgctaagtac
tgccccaatgctctggtcaatatgataagcaacccagtgaattccactgtccctattgct
gctgaggtgtttaagaaagctggaacttatgatgaaaagaagctctttggagttaccatg
cttgatgtggttagggccaagacattttatgctggaaaagctaaagtaaatgttgctgag
gtcaatctcccagtagttggtggtcatgctggcataactatcctcccattattttctcaa
gccactccaaaggcaaatctatcatatgaggaaattgttgcactcacaaagcgaacccaa
gatggtgggacagaagttgtagaagccaaagctggaaagggttcanccaccctctcaata
gcctatgctggggctatttttgccgatgcttgcttgaaggggttgaatggagttcccgat
gttgttgaatgtgcttttgtgcagtccaatgtcaccgagcttcccttcttcgcatccaag
gtaagacttgggaaaaatggagtggaggaagtcctagggttgggtccacttaacgactac
gagaagcaaggacttgaggctcttaagccagagctgctctcctccattgaaaagggaatc
aagtttgccaaagaaaactaa

DBGET integrated database retrieval system