KEGG   Solanum lycopersicum (tomato): 778295Help
Entry
778295            CDS       T02665                                 

Gene name
CHS2
Definition
chalcone synthase (EC:2.3.1.74)
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    778295 (CHS2)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    778295 (CHS2)
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     778295 (CHS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 389 aa AA seqDB search
MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMC
DKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
KSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAEN
NKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAMIIGSDPLPEVERPLFELV
SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFW
IAHPGGPAILDQVELKLSLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASSKEGLST
TGEGLDWGVLFGFGPGLTVETVVLHSVST
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccgttgaggaggttcgaagggcgcaacgtgcaaagggaccagctactatcatg
gccataggcacggcgactccttcgaactgtgttgatcaaagcacttatcctgattattat
tttcgaatcactaatagtgaacatatgactgagcttaaggagaaatttaagcgcatgtgt
gataaatcgatgattaataagagatatatgcatttaactgaagaaattttaaaagaaaac
ccaaatatttgtgaatacatggctccttctttggatgctagacaagatatagtggtggtt
gaagtgccaaaacttggcaaagaagcagcccaaaaggccattaaagaatggggtcagccc
aagtccaagatcacccatgtggtcttttgcaccactagtggggtggacatgcctggggcc
gactaccaactcaccaagcttcttgggcttcgaccttcggttaagcggctcatgatgtat
caacaaggttgctttgctggtgggaccgttatccgactggcaaaggacttagctgagaac
aacaagggtgctcgagttcttgttgtttgctcagagatcactgcagttacttttcgtggt
ccaagtgatactcatttggatagtatggttggacaagccctttttggtgatagggcagcc
gcaatgattataggttcagatccattaccagaagttgaaaggcctttgtttgaactcgtc
tctgcagcccaaactctactccctgatagcgaaggtgctattgatggtcaccttcgcgaa
gttgggctaacatttcacttgctcaaagatgttcctggattgatctcgaaaaacattgaa
aagagtttaattgaagcattccaaccgttaggcatttctgattggaattccatcttttgg
atcgcgcaccctggtgggccggcgattctagatcaagttgaactaaaactgagcctaaag
cccgaaaaacttcgggctactaggcaagttttaagtgactatggaaatatgtctagtgct
tgtgttctatttattttagatgaaatgagaaaggcctcatccaaagaagggcttagtacc
acaggtgaaggccttgattggggtgtactttttggatttgggcctgggcttactgttgag
actgttgtgctccatagtgtgtctacttag

  All links  
No link information was found.   
DBGET integrated database retrieval system