KEGG   Streptomyces avermitilis: SAV_1137Help
Entry
SAV_1137          CDS       T00126                                 

Gene name
melC1
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
sma  Streptomyces avermitilis
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAV_1137 (melC1)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAV_1137 (melC1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SAV_1137 (melC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1425261..1426085
Genome map
AA seq 274 aa AA seqDB search
MTVRKNQATLTADEKRRFVDALVALKRSGRYDEFVTTHNAFIMGDTDSGERTGHRSPSFL
PWHRRFLIEFEQALQAVDPSVALPYWDWSTDRTARASLWAPDFLGGSGRSLDGRVMDGPF
AASTGNWPVNVRVDSRTYLRRTLGGGGRELPTRAEVDSVLAMSTYDMAPWNSASDGFRNH
LEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYIDRLWAQWQSRHPGSGYVPTGG
TPNVVDLNETMKPWNDVRPADLLDHTAHYTFDTV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacgcaagaaccaggcgaccctgacggccgacgagaagcggcgcttcgtcgac
gcgctcgtggcgctcaagcgcagtggccgctacgacgagttcgtcacgacccacaacgcc
ttcatcatgggcgacaccgacagcggcgaacgcacgggccatcgttcgccttccttcctg
ccctggcaccgcagatttttgatcgagttcgagcaggcgctccaggcggtcgacccgtcg
gtcgcgctgccgtactgggactggagcaccgaccgcacggcgcgtgcctccctgtgggcg
cccgacttcctcggcggcagcggacgcagcctggacggccgggtgatggacgggccgttc
gcggcgtccaccggcaactggccggtcaacgtgcgggtcgacagccgtacgtatctgcgg
cgcacgctcggcggcggcgggcgcgagctgccgacccgggcggaggtcgactccgtgctc
gcgatgtccacgtacgacatggccccgtggaacagcgcgtcggacgggttccgcaaccat
ctcgagggctggcgcggtgtgaacctgcacaaccgcgtccacgtctgggtcggcggccag
atggccaccggggtctcccccaacgacccggtcttctggctccaccacgcctacatcgac
aggctctgggcccagtggcagagccgccacccgggctccggttatgtgccgacgggcggc
acgccgaacgtcgtcgacctgaacgagaccatgaagccgtggaacgacgtacgccccgcg
gacctgctggaccacaccgcgcactacacgttcgacaccgtctga

DBGET integrated database retrieval system