KEGG   Streptomyces avermitilis: SAV_1141Help
Entry
SAV_1141          CDS       T00126                                 

Gene name
adhA1
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAV_1141 (adhA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_1141 (adhA1)
  Lipid metabolism
   00071 Fatty acid degradation
    SAV_1141 (adhA1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAV_1141 (adhA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAV_1141 (adhA1)
   00626 Naphthalene degradation
    SAV_1141 (adhA1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAV_1141 (adhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1428660..1429664
Genome map
AA seq 334 aa AA seqDB search
MWAWEVERPGPIEDGPLRFVERPVPVPGPGELLVRVRACGVCRTDLHVSEGDLPVHRPRV
TPGHEVVGVVAGRGADAGGYAVGDRVGVAWLRRTDGTCRYCVRGAENLCPASEYTGWDTD
GGYAEYTTVPAAFAYRLPTDVDDVALAPLLCAGIIGYRALVRASLPPGGRLGLYGFGGSA
HLCAQVALAQGATVHVLTRDPASQRLALALGAASAGGAYDTPPEPLDSAILFAPAGGLVP
VALRALDRGGVLSVAGIHLSDTPPLCYERELFYEKELRSVTSNTRADGREFLELAARYGV
RATTHTYPLSEAQQALRDLKAGRFDGAAVLVNDV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcatgggaagtggagcggccgggtccgatcgaggacggtccgctgcggttcgtg
gagcggccggtcccggtaccgggacccggtgagctgctcgtgcgggtgcgcgcctgcggg
gtgtgccgtaccgacctgcacgtcagcgagggcgacctgccggtgcaccggccccgggtg
acacccgggcacgaggtcgtgggcgtggtggcgggacggggcgcggacgccggcggctac
gcggtcggggaccgggtgggggtggcctggctgcgccgtacggacggcacctgccggtac
tgcgtgcgcggggccgagaacctctgtccggcgtccgagtacaccggatgggacacggac
ggcggctacgccgagtacacgaccgtcccggccgcgttcgcgtaccggctgcccaccgac
gtcgacgacgtggcgctggcgccgctgctgtgcgcgggcatcatcggctaccgggcgctg
gtgcgggcgtcgctgccaccgggcgggcgactcggtctgtacgggttcggcggcagtgcc
cacctgtgcgcacaggtcgcgctcgcacagggcgccaccgtgcacgtactgacccgggac
ccggcctcgcagcggctcgcgctcgccctcggggccgcctcggcgggcggggcgtacgac
accccgccggagccgctggacagcgcgatcctgttcgcgccggccggcggtctggtgccg
gtcgcgctgcgggccctggaccgcggcggggtgctgtcggtcgccggcatccatctgagc
gacaccccgccgctgtgctacgaacgcgagctgttctacgagaaggagctgcgcagcgtc
acctcgaacacgcgcgcggacggccgggagttcctggagctggcggcccggtacggggtc
cgggccacgacgcacacctatcccttgtccgaggcgcagcaggccctgcgggatctgaag
gcgggccgcttcgacggggcggccgtcctggtcaacgacgtctga

DBGET integrated database retrieval system