KEGG   Streptomyces avermitilis: SAV_1325Help
Entry
SAV_1325          CDS       T00126                                 

Gene name
bga2
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sma  Streptomyces avermitilis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SAV_1325 (bga2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SAV_1325 (bga2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1635320..1637341)
Genome map
AA seq 673 aa AA seqDB search
MPETTPKGLTRLAFGGDYNPEQWPETVWQEDVRLMREAGVTMVSVGIFSWALLEPSPGAY
DFGWLDRLLDLLHENGIRADLGTPTVAPPAWFYRAHPEALPVTADGTRYEFGSRGAICHS
NADYRAAAANITTRLATRYAEHPALALWHVHNEYGVPVSACYCESCAAHFRRWLTDTYGT
IDALNEAWGTAFWGQRYAGFDQINPPRLTPTVGNPGQALDHKRFADATMRENFVAERDIL
HRLAPGIPVTTNFMTALSQCDSVDYWAWGREVDLVTNDHYLITDGRRTHVNLAMAADLTR
SVASGAPWLLLEHSTSGVNWQPHNPAKAPGQMARNSLAHVARGSEGAMFFQWRQSRRGAE
KFHSSMLPHGGTDTRVWREVVELGSSVDSLRSIRGTRTRADVAVLWDWQSWWAQNLQWRP
SEDHDPRERADAFYEALYDRHLTVDFAHPEADLSAYPLVVVPALYLMTEAAGNNLEEYVE
NGGTLVVSYFSGIVDEHDAVHDGPYPGALRDVLGLTVEEFSPLLKDDRIRVTGPDGSELT
GDVWSEFVVPRGAETVWTYADGLTAGHPAVTRHRFGEGSAWYVSTRLTAQGLDALLGRAA
DDARIAPRADLPRDVEVVCRTGESGTFLFAVNHTALDTKVPLDAHGTELLTGERAAGQVS
VPAGAVRVVRLDG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaccacccccaagggcctcaccaggctcgccttcggtggggactacaacccc
gagcagtggccggaaaccgtatggcaggaggacgtccggctgatgcgagaggccggcgtc
accatggtgagcgtcggcatcttctcctgggcactgctcgaaccctcgccgggcgcctac
gacttcggctggctcgaccgcctgctcgacctgctgcacgagaacggcatccgcgcggac
ctcggcacgcctacggtggcaccgcccgcctggttctaccgcgcccaccccgaagcgctg
ccggtgaccgccgacggcacccgctacgagttcggctcccgcggcgccatctgccacagc
aacgcggactaccgggccgccgccgcgaacatcaccacccggctcgccacccgctacgcc
gagcaccccgccctcgcgctgtggcacgtccacaacgagtacggcgtccccgtctcggcc
tgctactgcgagagctgcgccgcccatttccgccgctggctcacggacacctacggaacg
atcgacgccctcaacgaggcatggggcaccgccttctggggccagcgctacgccggcttc
gaccagatcaacccgccgcgcctgacgcccacggtcggcaatccgggccaggcgctcgac
cacaagcggttcgccgacgccaccatgcgcgagaacttcgtcgccgagcgggacatcctg
caccgcctcgcgcccggcatcccggtgaccaccaacttcatgaccgccctgagccagtgc
gactccgtggactactgggcctggggccgcgaggtcgacctcgtcaccaacgaccactac
ctgatcaccgacggccgccgcacccacgtcaacctcgcgatggccgccgacctcacgcgt
tccgtggcgagcggcgccccctggctgctgctcgaacactccacctcgggcgtcaactgg
cagccccacaaccccgccaaggctcccggccagatggcccgcaactccctcgcccatgtg
gcacgcggctccgagggcgcgatgttcttccagtggcggcagtcccggcgcggcgcggag
aagttccactcgtcgatgctgccgcacggcggcacggacacacgggtgtggcgcgaggtg
gtcgaactcggctcctccgtcgactcgttgcgttcgatccgcgggacccggacccgcgcc
gacgtggccgtcctgtgggactggcagtcctggtgggcgcagaacctccagtggcgcccc
agcgaggaccacgatccgcgcgagcgtgccgacgcgttctacgaggcgctctacgaccgc
cacctgaccgtcgacttcgcgcacccggaagccgacctgtcggcctacccgctggtcgtc
gtgcccgcgctctacctgatgaccgaggccgccgggaacaacctcgaggagtacgtcgag
aacggcggcacccttgtcgtctcctacttctccggcatcgtcgacgagcacgacgccgtg
cacgacggcccctacccgggcgccctgcgtgacgtactcggcctgaccgtcgaggagttc
tcgccgctcctgaaggacgaccggatccgcgtcaccggccccgacggctccgagctcacg
ggcgacgtgtggagcgagttcgtggtgccccgcggcgccgagaccgtctggacgtacgcc
gacgggctcaccgcgggccaccccgcggtcacccggcaccggttcggcgagggctccgcc
tggtacgtctccacccggctgaccgcccagggcctcgacgcccttctgggccgggccgcc
gacgacgcccggatcgcgccgcgcgccgatctgccccgcgatgtcgaagtggtgtgccgc
acgggcgagtccggcaccttcctgttcgccgtcaaccacaccgcgctcgacaccaaggtg
ccgctcgacgcccacggcaccgagctgctcacgggtgagcgcgccgccggacaggtgtcc
gtgcccgcgggcgccgtcagggtcgtacgactcgacggctga

DBGET integrated database retrieval system