KEGG   Streptomyces avermitilis: SAV_1357Help
Entry
SAV_1357          CDS       T00126                                 

Gene name
adhA2
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAV_1357 (adhA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_1357 (adhA2)
  Lipid metabolism
   00071 Fatty acid degradation
    SAV_1357 (adhA2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAV_1357 (adhA2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAV_1357 (adhA2)
   00626 Naphthalene degradation
    SAV_1357 (adhA2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAV_1357 (adhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1673000..1674022
Genome map
AA seq 340 aa AA seqDB search
MSTYRAAQVAAASGPFEIVQREVPRPGPGHVRIAVDACGICHSDSVFVDALLPGVRFPLV
PGHEIAGHIDELGEGTDISWQVGDRVAVGWFGGSCGHCPPCRQGDFVVCQNLKVPGWAYD
GGYAEAVIAPADALARIPDALAATDAAPLGCAGVTTYNGLRRSSARPGDLVAVLGIGGLG
HLGVKYAAAMGFETVAIARGSDKADFAKQLGAHHYIDSTADTTVADALQSLGGAKAVLAT
AANSDAITATVDGLAPRGELVAIGVDAEPLGISPNQLLMGGKIIRGHPSGTAQDVQDTMA
FSALHGIRPMTETVPLDQADEAYRKMMSGAARFRMVLTTG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtacttatcgagcagcgcaggtggccgccgcgagcggtccgttcgagatcgtccag
cgtgaggtgccgcggcccggccccggccatgtccggatcgccgtggacgcctgcgggatc
tgccacagcgactccgtcttcgtcgacgccctgttgccgggcgtccggtttccgctggtc
cccgggcatgagatcgccgggcacatcgacgagctcggcgagggaacggacatcagctgg
caggtgggcgaccgggtggcggtgggctggttcggcggcagctgcggccactgcccgccc
tgcagacagggcgacttcgtcgtgtgccagaacctgaaggtccccggatgggcgtacgac
ggaggctacgccgaggcggtgatcgcaccggccgacgccctggcccggatccccgacgcg
ctggcggcgaccgacgcggcacccctgggctgcgcgggagtgaccacgtacaacgggctg
cgacgcagctccgcgcggccgggcgatctcgtcgccgtcctcggcatcggtggcctcggc
cacctgggggtgaagtacgcggccgccatgggcttcgagaccgtggccatcgcccgcgga
tccgacaaggccgacttcgccaagcagctcggcgcacaccactacatcgacagcacggcg
gacaccaccgtcgcggatgcgctgcagtccctcggcggcgccaaggccgtgctggccacc
gccgccaactcggacgccatcacggcgaccgtggatgggctcgcgccccgcggcgagctg
gtggccatcggtgtggacgccgagccgctgggcatcagcccgaaccagctgctcatgggc
ggcaagatcatccgcggtcatccgtccggcaccgcgcaggacgtgcaggacaccatggcg
ttcagcgccctgcacgggatccggccgatgaccgagaccgtgccgctggaccaggccgat
gaggcgtaccggaagatgatgtccggcgccgcccgcttccgcatggtgctcaccaccggc
tga

DBGET integrated database retrieval system