KEGG   Streptomyces avermitilis: SAV_1393Help
Entry
SAV_1393          CDS       T00126                                 

Gene name
adhA3
Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAV_1393 (adhA3)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SAV_1393 (adhA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1719247..1720272
Genome map
AA seq 341 aa AA seqDB search
MKAVQVIEYDEPPALVDVPDPQITGPLDVIVKIGGAGVCRTDLHILEGQWKDKSGVALPY
TIGHENAGWVAEVGQAVTHVKVGDPVILHPLVTCGLCRACRAGDDVHCMNSAFPGIDTAG
GYAEYLKTNARSIVPLAPSLEPASVAALADAGLTAYHAVAKAARVLRPGDKAVVIGAGGL
GHIGIQVLRALSPVEMIVIDRSPEALALAKELGADHTLVADGSEAERVRDLTAGHGAEAV
LDFVGEGGAVETGVACLRRNGNYHVIGYGGRLNVPTIDVISTEINFIGNLVGSYNDLSEL
MVLAAQGKVTLHTQRYPLASFRQALDDLDTGAVRGRAILIP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtgcaggtcatcgagtacgacgagccgcccgcgctcgtggacgtaccggac
ccgcagatcaccggcccgctggatgtgatcgtgaagatcgggggcgccggagtctgccgg
accgatctgcacatcctcgaaggacagtggaaggacaagagcggggtcgcccttccgtac
acgatcggtcatgagaacgccggctgggtcgccgaggtcgggcaggccgtgacccacgtc
aaggtcggtgacccggtcatcctgcacccgctggtgacctgcggtctgtgccgcgcctgc
cgggccggcgacgacgtgcactgcatgaactcggcattccccggcatcgacaccgccggg
ggctacgccgagtacctgaagaccaacgcccgctccatcgtgcccctcgccccgtccctg
gagccggcctcggtggcggccctggccgacgccgggctcacggcgtaccacgccgtcgcc
aaggcggcgcgggtgctgcggcccggtgacaaggccgtggtcatcggcgccggcggactc
gggcacatcgggattcaggtgctgcgggccctgtcgccggtcgagatgatcgtcatcgac
cgcagcccggaggccctcgcgctggccaaggaactgggcgccgaccacacgctcgtcgcg
gacggaagcgaggccgaacgcgtacgggacctcaccgcggggcacggggcggaggccgtc
ctggacttcgtcggcgaagggggcgccgtcgagacgggagtggcctgcctgcgccgcaac
ggcaattaccacgtcatcggttacggcggccgtctgaacgtgccgacgatcgacgtcatc
tccacggagatcaacttcatcggcaacctcgtcgggtcctacaacgacctctccgagctg
atggtcctggcggcccagggcaaggtcaccctgcacacccagcgctaccccctcgcctcc
ttccggcaggccctcgacgacctggacaccggggccgtacgcggccgagcgatcttgatc
ccctga

DBGET integrated database retrieval system