KEGG   Streptomyces avermitilis: SAV_1420Help
Entry
SAV_1420          CDS       T00126                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sma  Streptomyces avermitilis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sma00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sma00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1753546..1754346)
Genome map
AA seq 266 aa AA seqDB search
MNAPLVLPGPHATSLDLGGRTALVTGAAGGIGRACALRLAAAGAKVRAVDRDPEGLDTLA
EAARGLAGTVEPQVLDLTDLDAAELSAAGTDVLVNNAGLQLVRPIEEFPPEAFHTVLTVM
LEAPFRLIRGALPHMYGQGWGRIVNVSSVHGLRASAFKSAYVAAKHGLEGLSKTAALEGA
PHGVTSNCVNPAYVRTPLVEKQLVDQAAAHGIPEERVLSEVLLRDSAVKRLIEPAEVAEA
VAYLCSPQASFITGTSLALDGGWTAH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcccctggtcctccccggcccgcacgccacctccctcgacctcggcggtcgg
accgccctggtcaccggcgccgcaggcggcatcggcagggcctgtgcgctgcggctggcc
gccgccggggccaaggtgagagcggtcgaccgcgaccccgagggcctggacaccctcgcc
gaagccgcacggggcctcgcgggcacggtcgagcctcaggtcctcgacctcaccgatctg
gacgccgcggaactctccgccgcgggaaccgacgtccttgtcaacaacgccgggctccaa
ctggtccgtcccatcgaggagttcccgccggaggccttccacaccgtgctgacggtcatg
ctggaggcacccttccggctcatccgcggtgccctgccccacatgtatggacagggctgg
gggcggatcgtcaatgtgtcgtcggtgcacgggctgcgcgcctcggcgttcaaatcggcg
tacgtggcggcgaagcacggcctggaggggctctcgaagaccgccgcgctcgaaggcgcg
ccgcacggcgtcacctcgaactgtgtgaaccccgcctatgtgcgcaccccgctggtcgag
aaacagctcgtcgaccaggcagcggcgcacgggatccccgaggagcgcgtgctgtccgag
gtgctgctccgggacagcgcggtcaagcggctcatcgagccggcggaggtcgccgaggcg
gtggcctatctgtgcagcccgcaggcgtccttcatcaccggtacgtcgctggcgctggac
ggcggctggaccgcacactga

DBGET integrated database retrieval system