KEGG   Streptomyces avermitilis: SAV_1425Help
Entry
SAV_1425          CDS       T00126                                 

Gene name
murI
Definition
glutamate racemase
Orthology
K01776  
glutamate racemase [EC:5.1.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:sma00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1758546..1759331)
Genome map
AA seq 261 aa AA seqDB search
MKIALLDSGIGLLAAAAAVRRLRPDADLVLSSDPASVPWGPRTPQDVTERSLAVAEAAAA
HRPDALIAACNTMSVHALPALRARFEPGLPVIGTVPAIKPAAASGGPVAIWATPATTGSP
YQRGLIREFADGVAVTEVPCPGLADAVEHANEAAIDAAIAAAAERTPDDVRVVVLGCTHY
ELVAERIRAAVQKPGLPPLVLHGSAGAVAAQALRRIGELPAPEAPMGASLTVLLGGREET
LPAPALAYEEGQLLQTLSTAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgcgctccttgactccggaatcgggctgctcgcggcagccgccgcggtacgt
cgactgcggcccgacgccgatctcgttctctcctcggaccccgccagcgtgccgtgggga
ccgcgcactccacaggacgtgacggaacgttccctcgccgtcgccgaggcggccgccgcg
caccgcccggacgcgctgatcgccgcctgcaacaccatgtcggtgcacgcccttcccgcg
ttgcgggcccgcttcgaacccggactgccggtcatcggcaccgttccggcgatcaagccc
gccgcggcgagtggcggtccggtggcgatctgggcgacgcccgccaccaccggcagcccg
taccagcgcggtctcattcgggagttcgccgacggagtggcggtcaccgaggtgccgtgt
cccggcctcgccgacgccgtggagcacgcgaacgaagcggccatcgacgccgcgatcgcc
gcggccgcggagcgcaccccggacgatgtaagggtcgttgtcctgggctgcactcattac
gaactcgtcgccgagcgtattcgcgccgccgtgcagaagccgggccttccgccgctcgtc
ctgcacggttccgcaggagcggtggccgcgcaggcgctgcgcaggatcggcgagctgccc
gcgcccgaggcacccatgggcgcctccctcaccgtgctcctcggcgggcgcgaggaaacg
ctgcccgcaccggcactcgcgtacgaggaaggccagctgctgcagaccctcagcacagcg
cgttga

DBGET integrated database retrieval system