KEGG   Streptomyces avermitilis: SAV_1476Help
Entry
SAV_1476          CDS       T00126                                 

Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_1476
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_1476
   00052 Galactose metabolism
    SAV_1476
   00500 Starch and sucrose metabolism
    SAV_1476
   00520 Amino sugar and nucleotide sugar metabolism
    SAV_1476
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAV_1476
   00524 Butirosin and neomycin biosynthesis
    SAV_1476
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAV_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1819858..1820817)
Genome map
AA seq 319 aa AA seqDB search
MHTDLVAALDIGGTKIAGALVDGHGRILLRAQRATPAQEDGDTVMGAVEDVIGELTGSSL
WGGATAVGIGSAGPVDASAGTVSPVNVPGWRDYPLVERVRKATAGLPVELIGDGVAITAA
EHWQGAARGHDNALCMVVSTGVGGGLVLGGQLHSGPTGNAGHIGHISVDLDGDLCPCGSR
GCVERIASGPNIARRALEGGWQPGPDGDTSAAAVAAAARAGDPVAVASFERAAQALAAGI
AATATLVEVDIAVIGGGVGKAGDVLFTPLRAALRDYATLSFVQRLTVTPAQMGTDAGLVG
AAAAALSRKPSATAVGVSG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgacctcgtggccgcgctcgacatcggcggcaccaagatcgccggagcgctg
gtggacggccacggccggatcctgttgcgtgcccagcgcgccacgcccgcgcaggaggac
ggcgacaccgtgatgggtgccgtcgaggacgtcataggcgagttgaccggctcctcgctg
tggggcggggcgacggccgtcggcatcggcagcgcgggccccgtggacgcctccgcgggc
acggtgagccccgtgaacgtgccggggtggcgcgactacccgctggtcgagcgggtccgc
aaggccacggcggggctgcccgtcgagctgatcggcgacggtgtggcgatcacggcggcc
gagcactggcagggcgcggctcgcggccacgacaacgcgctgtgcatggtcgtgtccacc
ggcgtcggcggtggcctggtcctcggcgggcagttgcactcgggccccaccggcaacgcg
ggccacatcgggcacatcagcgtggacctcgacggcgacctgtgcccatgcggttcccgc
ggctgcgtggagcgcatcgcgagcggacccaacatcgcgcgccgcgcgctggagggcggc
tggcagccgggccccgacggtgacacctcggccgccgcggtggccgccgccgcgcgggcg
ggcgacccggtggccgtggcctccttcgagcgggcggcccaggcgctggccgcggggatc
gccgcgaccgcgaccctcgtcgaggtcgacatcgccgtcatcggcgggggagtgggcaag
gcgggggatgtcctcttcacgccgctgcgggccgcgctgcgggactacgccaccctgtcg
ttcgtgcagcggctgaccgtgacgcccgcgcagatgggcacggacgccggtctggtcggc
gccgcggcggccgcgctcagcaggaagccgagcgcgaccgccgtcggggtgagcggctga

DBGET integrated database retrieval system