KEGG   Streptomyces avermitilis: SAV_1520Help
Entry
SAV_1520          CDS       T00126                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sma  Streptomyces avermitilis
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAV_1520
Enzymes [BR:sma01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SAV_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1862701..1863681
Genome map
AA seq 326 aa AA seqDB search
MSDKIALSTWPTPLEPMPRLAAALGLGENDLWIKRDDLIGLGGGGNKVRKLEWTVGAALA
AGADTLVTTGAAQSNHARLTAAAGARLGLDVVLVFPGTPDSATHGSGNLVLDSLFGARVH
WAGDGGPSTMGDVADEVCRQLRRDGARPHLIPFGGSSPLGARGYVEGGEELRSQLPDVDH
VVVALGSGGTMAGLVGALGEQRVLGVHCGAVAEPAATVADLAGPLTRRSITPESLRLRTD
QVGAGYGVLHEPVLEAMRTAAGTEGIVLDPVYSGRAMAGLIAAVRDGDIRPAQRTVFLHT
GGLPGLFGHTETVQRSVSTLRSYEVE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaagatcgccctgtcgacgtggcccacaccgctggagcccatgccccgtctg
gcggcggcactgggcctcggcgagaacgacctctggatcaaacgggacgacctcatcggc
ctgggcggcggtggcaacaaggtccgcaaactggaatggaccgtcggcgccgccctcgcg
gcaggcgcggacaccctggtcaccaccggcgccgcgcagagcaaccacgcccgcctcacc
gcggccgccggcgcccgcctgggactcgacgtcgtactcgtcttccccggcactcccgac
agcgccacgcacggctccggcaacctcgttctcgacagcctcttcggagccagggtccac
tgggccggagacggcggcccgagcacgatgggtgacgtcgccgacgaggtctgccggcag
ctgcgccgcgatggagcacgccctcatctcatccccttcggggggtcaagtcccctcggg
gcgcggggatacgtggaaggcggcgaggaactgcgctcccaactgcccgacgtggaccac
gtcgtggtcgccctcggttccggcggcaccatggcgggactggtcggcgcactcggggag
caacgcgtcctcggcgttcactgcggggcggtggcagagccggccgccaccgtcgccgac
ctcgcgggcccactcacccgccgcagcatcaccccggaatccctgcgccttcgcaccgac
caggtgggtgcgggatacggagtgcttcatgagccggtcctggaagcgatgcgaaccgcc
gcaggcaccgagggcatcgtcctggatccggtctacagcgggcgcgccatggccggcctg
atcgccgcggtgcgggacggcgacatccgcccggcccagcgcaccgtatttcttcacacc
ggggggctcccgggcctgttcgggcatacggagaccgtgcagcgctccgtcagcaccctg
cgctcctacgaggtcgagtga

DBGET integrated database retrieval system