KEGG   Streptomyces avermitilis: SAV_1547Help
Entry
SAV_1547          CDS       T00126                                 

Gene name
rpiB1
Definition
ribose-5-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
sma  Streptomyces avermitilis
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:sma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sma01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sma00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sma00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1890784..1891254)
Genome map
AA seq 156 aa AA seqDB search
MRISVSSDMDEPVARSLLAELRGRGHEVVAHGALRPGDDTRWAACSAAAAREVATGTSDQ
AVVCCWTGTGASIAANKVPGVRAALCTDAYTADGARRWNDANVLALSLRLTSQPLLREIL
DAWFAAEAGEDADDRENVAHVGRLDADRTGGAADRG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctccgtctcctcggacatggacgaacccgtggcccgctctctgctcgcggaa
ctgcgcggccgcggccacgaggtcgtggcgcacggcgcgctgcgccccggcgacgacacg
cggtgggcggcgtgctcggcggcggcggcccgggaggtcgccaccgggacgtcggaccag
gcggtcgtgtgctgctggaccggcacgggcgcgtcgatcgccgcgaacaaggtgcccggc
gtgcgggcggctctgtgcacggacgcgtacacggcggacggcgcacgccgctggaacgac
gccaacgtgctggcgctcagcctgcggctgacgtcccagcccctgctcagggagatcctc
gacgcctggttcgccgccgaggccggcgaggacgccgacgaccgggagaacgtggcgcac
gtcgggcggctggacgcggacaggaccgggggcgccgccgaccgcgggtga

DBGET integrated database retrieval system