KEGG   Streptomyces avermitilis: SAV_1641Help
Entry
SAV_1641          CDS       T00126                                 

Gene name
agaB3
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sma  Streptomyces avermitilis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sma00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sma00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sma00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2010083..2012185)
Genome map
AA seq 700 aa AA seqDB search
MSTSVDICGGLMVEIAEDRRTWLLSGPTSSYAVHLTEGHELLHLHWGPRIALADAEALAA
LPAPGGSSFESPLDGREEYPVEGGPRFVRPALSVRTDERRGTEWRFEAYETEGDELRLRF
GDSGLAVTLHYRMRDDVVERWVTLANDGPALELLRADSATWTLPERDGWRLSQLHGRWAA
ESRLVRSDLTYGEKIIGSRRGHTGHQHLPWVALDCEATEESGEVYGCALGWSGSWRISVA
QLSDARVQITGGAGYDDSGLLRLGPGESFTTPVFAGLWSDGGFGGASRAWHAYQRAYVIP
DADQDRPVLFNSWEATTFDISEEQQGALARRAAAMGVELFVVDDGWFGARTGDRAGLGDW
TPNPDRFPAGLKPLADYVHALGMQFGIWVEPEMVNPDSELYRAHPDWVQFQPGRTRTEFR
NQLVLNLAREDVQQCLWEQLDGLLSSAPVDYVKWDFNRCFTDAGWPGEAYPQRLWVDHVR
ALYRLLDRLRAAHPGVAFESCSGGGGRIDLGIMARTDQVWTSDNTDPLDRLAIQHGFSQI
HPARVMAAWVTDSPNTQLNGRVSTLRLRFVSAMAGVLGVGGDLAEWSERELVEARDWVSL
YKEIRPVVQRGDLYRLRPPTGGLSAVQYVHGDEAVVLAWLQAQHYGEPVAPLRLRGLDPA
ATYECRETGEVHRGAVLLHHGLRTGLHGDLDATVVRLRRI
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
ttgagtacatctgttgacatctgtgggggcctgatggttgagatcgccgaagaccgacgt
acgtggcttctttcggggcccacgagcagctacgccgtgcatctcaccgagggtcacgaa
ctgctgcatctgcactggggcccgcggatcgccctcgccgacgccgaggccctcgccgcc
ctccccgccccgggcggctcgtccttcgaatcgccgctggacgggcgtgaggagtacccg
gtcgagggcggcccccgcttcgtacgcccggcgctgtccgtgcgcaccgacgagcgccgt
ggcaccgagtggcgcttcgaggcgtacgagaccgaaggcgacgagctgcggctgcggttc
ggcgactcggggctggccgtcacgctgcactaccggatgcgggacgacgtcgtcgagcgc
tgggtgacgctggccaacgacggacccgccctggagctgctgcgcgccgactccgccacc
tggaccctgcccgagcgcgacggctggcggctgtcccagctgcacgggcgctgggcggcc
gagtcccgcctcgtacgctcggacctcacctacggcgagaagatcatcggcagccggcgc
gggcacaccgggcaccagcatctgccgtgggtcgcgctcgattgcgaggcgaccgaggag
agcggcgaggtctacggctgcgcgctcggctggtccggctcctggcgcatctcggtggcc
caactctccgacgcgcgcgtgcagatcaccggcggcgcggggtacgacgactcgggcctg
ctgcgcctggggccgggggagtcgttcacgacgcccgtcttcgcggggctgtggagcgac
ggcggcttcggcggcgcgagccgcgcctggcacgcgtaccagcgggcgtacgtcatcccg
gacgcggaccaggaccgtccggtgctcttcaattcctgggaggccaccaccttcgacatc
tccgaggaacagcagggggctctcgcgcggcgggccgcggcgatgggggtcgagctgttc
gtggtcgacgacggctggttcggggcgcggaccggcgaccgggccgggctcggcgactgg
acgcccaaccccgaccgcttcccggccgggctcaagccgctcgccgactacgtgcacgcg
ctcggcatgcagttcggcatctgggtcgagcccgagatggtcaacccggacagcgagctg
taccgcgcgcacccggactgggtgcagttccagccggggcggaccaggacggaattccgc
aaccagctggtcctcaacctcgcgcgcgaggacgtccagcagtgcctctgggagcagctc
gacggactgctgtccagcgcccccgtcgactacgtgaagtgggacttcaaccgctgcttc
acggacgccggctggcctggggaggcatatccgcagcggctctgggtcgatcatgtgcgc
gccctgtaccgcctgctggaccggctgcgggccgcgcatccgggggtcgccttcgagtcc
tgctcgggcggtggcggccggatcgacctgggcatcatggcgcgtacggaccaggtgtgg
acctccgacaacaccgacccgctcgaccggctcgccatccagcacggattcagccagatc
caccccgcccgggtcatggccgcctgggtcaccgacagcccgaacacacagctcaacggg
cgagtcagcacgctgcgcctccggttcgtcagcgccatggcgggagtgctcggggtcggc
ggcgatctggccgagtggagcgagcgggaactcgtcgaggcacgggactgggtgagtctc
tacaaggagatccggcccgtcgtgcagcgcggggacctctaccggctgcggcccccgacg
ggcgggctgagcgccgtgcagtacgtccacggcgacgaggccgtcgtcctcgcctggctc
caggcccagcactacggcgagccggtcgccccgctccggctgcgcggcctcgacccggca
gccacctatgaatgccgtgaaacgggcgaagtgcaccgaggtgccgtactgctgcatcac
gggctgcggacggggttgcacggggacctcgatgcgacggttgttcggctacgtcgcatt
tga

DBGET integrated database retrieval system