KEGG   Streptomyces avermitilis: SAV_1641Help
Entry
SAV_1641          CDS       T00126                                 

Gene name
agaB3
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sma  Streptomyces avermitilis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SAV_1641 (agaB3)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SAV_1641 (agaB3)
   00600 Sphingolipid metabolism
    SAV_1641 (agaB3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SAV_1641 (agaB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2010083..2012185)
Genome map
AA seq 700 aa AA seqDB search
MSTSVDICGGLMVEIAEDRRTWLLSGPTSSYAVHLTEGHELLHLHWGPRIALADAEALAA
LPAPGGSSFESPLDGREEYPVEGGPRFVRPALSVRTDERRGTEWRFEAYETEGDELRLRF
GDSGLAVTLHYRMRDDVVERWVTLANDGPALELLRADSATWTLPERDGWRLSQLHGRWAA
ESRLVRSDLTYGEKIIGSRRGHTGHQHLPWVALDCEATEESGEVYGCALGWSGSWRISVA
QLSDARVQITGGAGYDDSGLLRLGPGESFTTPVFAGLWSDGGFGGASRAWHAYQRAYVIP
DADQDRPVLFNSWEATTFDISEEQQGALARRAAAMGVELFVVDDGWFGARTGDRAGLGDW
TPNPDRFPAGLKPLADYVHALGMQFGIWVEPEMVNPDSELYRAHPDWVQFQPGRTRTEFR
NQLVLNLAREDVQQCLWEQLDGLLSSAPVDYVKWDFNRCFTDAGWPGEAYPQRLWVDHVR
ALYRLLDRLRAAHPGVAFESCSGGGGRIDLGIMARTDQVWTSDNTDPLDRLAIQHGFSQI
HPARVMAAWVTDSPNTQLNGRVSTLRLRFVSAMAGVLGVGGDLAEWSERELVEARDWVSL
YKEIRPVVQRGDLYRLRPPTGGLSAVQYVHGDEAVVLAWLQAQHYGEPVAPLRLRGLDPA
ATYECRETGEVHRGAVLLHHGLRTGLHGDLDATVVRLRRI
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
ttgagtacatctgttgacatctgtgggggcctgatggttgagatcgccgaagaccgacgt
acgtggcttctttcggggcccacgagcagctacgccgtgcatctcaccgagggtcacgaa
ctgctgcatctgcactggggcccgcggatcgccctcgccgacgccgaggccctcgccgcc
ctccccgccccgggcggctcgtccttcgaatcgccgctggacgggcgtgaggagtacccg
gtcgagggcggcccccgcttcgtacgcccggcgctgtccgtgcgcaccgacgagcgccgt
ggcaccgagtggcgcttcgaggcgtacgagaccgaaggcgacgagctgcggctgcggttc
ggcgactcggggctggccgtcacgctgcactaccggatgcgggacgacgtcgtcgagcgc
tgggtgacgctggccaacgacggacccgccctggagctgctgcgcgccgactccgccacc
tggaccctgcccgagcgcgacggctggcggctgtcccagctgcacgggcgctgggcggcc
gagtcccgcctcgtacgctcggacctcacctacggcgagaagatcatcggcagccggcgc
gggcacaccgggcaccagcatctgccgtgggtcgcgctcgattgcgaggcgaccgaggag
agcggcgaggtctacggctgcgcgctcggctggtccggctcctggcgcatctcggtggcc
caactctccgacgcgcgcgtgcagatcaccggcggcgcggggtacgacgactcgggcctg
ctgcgcctggggccgggggagtcgttcacgacgcccgtcttcgcggggctgtggagcgac
ggcggcttcggcggcgcgagccgcgcctggcacgcgtaccagcgggcgtacgtcatcccg
gacgcggaccaggaccgtccggtgctcttcaattcctgggaggccaccaccttcgacatc
tccgaggaacagcagggggctctcgcgcggcgggccgcggcgatgggggtcgagctgttc
gtggtcgacgacggctggttcggggcgcggaccggcgaccgggccgggctcggcgactgg
acgcccaaccccgaccgcttcccggccgggctcaagccgctcgccgactacgtgcacgcg
ctcggcatgcagttcggcatctgggtcgagcccgagatggtcaacccggacagcgagctg
taccgcgcgcacccggactgggtgcagttccagccggggcggaccaggacggaattccgc
aaccagctggtcctcaacctcgcgcgcgaggacgtccagcagtgcctctgggagcagctc
gacggactgctgtccagcgcccccgtcgactacgtgaagtgggacttcaaccgctgcttc
acggacgccggctggcctggggaggcatatccgcagcggctctgggtcgatcatgtgcgc
gccctgtaccgcctgctggaccggctgcgggccgcgcatccgggggtcgccttcgagtcc
tgctcgggcggtggcggccggatcgacctgggcatcatggcgcgtacggaccaggtgtgg
acctccgacaacaccgacccgctcgaccggctcgccatccagcacggattcagccagatc
caccccgcccgggtcatggccgcctgggtcaccgacagcccgaacacacagctcaacggg
cgagtcagcacgctgcgcctccggttcgtcagcgccatggcgggagtgctcggggtcggc
ggcgatctggccgagtggagcgagcgggaactcgtcgaggcacgggactgggtgagtctc
tacaaggagatccggcccgtcgtgcagcgcggggacctctaccggctgcggcccccgacg
ggcgggctgagcgccgtgcagtacgtccacggcgacgaggccgtcgtcctcgcctggctc
caggcccagcactacggcgagccggtcgccccgctccggctgcgcggcctcgacccggca
gccacctatgaatgccgtgaaacgggcgaagtgcaccgaggtgccgtactgctgcatcac
gggctgcggacggggttgcacggggacctcgatgcgacggttgttcggctacgtcgcatt
tga

DBGET integrated database retrieval system