KEGG   Streptomyces avermitilis: SAV_1672Help
Entry
SAV_1672          CDS       T00126                                 

Gene name
dao
Definition
D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAV_1672 (dao)
   00330 Arginine and proline metabolism
    SAV_1672 (dao)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    SAV_1672 (dao)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SAV_1672 (dao)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     SAV_1672 (dao)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2046352..2047305
Genome map
AA seq 317 aa AA seqDB search
METGRSGEVIVVGGGVIGLTTAIVLAESGRRVRVWTREPVERTTSAVAGALWWPYRIEPA
ASARAWALTSFDVYEELATRPGRTGVRMVEGVQGGATLEETEAWALGRALGLRAATAEEC
PGGGLWARLPLIDMPAHLRWLRERFTAAGGTVETRTVTDLAEAKAPVVVNCTGLGARDLV
PDTSVRPVRGQLVVVENPGIRTWLVSTGADGEMAYFFPQPGRLLLGGTAVEDEWSLVPDP
AVAEAIVRRCAAWRPEIAGARVLEHRTGLRPARGTVRLEREPLSDGRVLVHNYGHGGAGV
TVAWGCAQEAAGLAASW
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggagactggtcgaagcggtgaggtcatcgtggtcggcggcggcgtcatagggctgacg
acggcgatcgtcctggcggagagcggccggcgcgtacgcgtgtggacgcgggagccggtc
gagcggaccacctcggcggtggcgggcgcgctgtggtggccgtatcggatcgagccggcg
gcgtcggcccgcgcgtgggccctcacctcgttcgatgtgtacgaggaactggcgacacgc
cccgggcgaaccggtgtacgcatggtcgaaggcgtgcagggcggggcgacgctggaggag
accgaggcgtgggcattgggccgggccctcgggctgcgggcggcgacggccgaggagtgt
cccgggggcgggctgtgggcacggctgccgctgatcgacatgccggcgcatctgcggtgg
ctgcgcgagcggttcaccgcggcgggcgggacggtcgagacccgtacggtgaccgacctc
gcggaggccaaggcgccggtcgtggtcaactgcacgggcctgggcgcccgtgacctcgta
ccggacacgtcggtgcgtcccgtgcgggggcagctcgtcgtcgtggagaaccccggcatc
cgcacctggctcgtctccaccggggccgacggggagatggcgtacttcttcccgcagccg
ggccggcttctgctcggcggcacggcggtcgaggacgagtggtccctcgtgcccgatccg
gcggtggccgaggcgatcgtgcggcgctgtgcggcgtggcgacccgagatcgccggggcg
cgggtcctggagcaccggacggggctgcggccggcgcgcggcacggtccggctggaacgc
gaaccgctctcggacggacgggtgttggtgcacaactacggccacggcggcgcgggcgtc
accgtggcctgggggtgcgcccaggaggcggcagggctggccgcctcctggtga

DBGET integrated database retrieval system