KEGG   Streptomyces avermitilis: SAV_1672Help
Entry
SAV_1672          CDS       T00126                                 

Gene name
dao
Definition
D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sma00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sma00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:sma00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:sma00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2046352..2047305
Genome map
AA seq 317 aa AA seqDB search
METGRSGEVIVVGGGVIGLTTAIVLAESGRRVRVWTREPVERTTSAVAGALWWPYRIEPA
ASARAWALTSFDVYEELATRPGRTGVRMVEGVQGGATLEETEAWALGRALGLRAATAEEC
PGGGLWARLPLIDMPAHLRWLRERFTAAGGTVETRTVTDLAEAKAPVVVNCTGLGARDLV
PDTSVRPVRGQLVVVENPGIRTWLVSTGADGEMAYFFPQPGRLLLGGTAVEDEWSLVPDP
AVAEAIVRRCAAWRPEIAGARVLEHRTGLRPARGTVRLEREPLSDGRVLVHNYGHGGAGV
TVAWGCAQEAAGLAASW
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggagactggtcgaagcggtgaggtcatcgtggtcggcggcggcgtcatagggctgacg
acggcgatcgtcctggcggagagcggccggcgcgtacgcgtgtggacgcgggagccggtc
gagcggaccacctcggcggtggcgggcgcgctgtggtggccgtatcggatcgagccggcg
gcgtcggcccgcgcgtgggccctcacctcgttcgatgtgtacgaggaactggcgacacgc
cccgggcgaaccggtgtacgcatggtcgaaggcgtgcagggcggggcgacgctggaggag
accgaggcgtgggcattgggccgggccctcgggctgcgggcggcgacggccgaggagtgt
cccgggggcgggctgtgggcacggctgccgctgatcgacatgccggcgcatctgcggtgg
ctgcgcgagcggttcaccgcggcgggcgggacggtcgagacccgtacggtgaccgacctc
gcggaggccaaggcgccggtcgtggtcaactgcacgggcctgggcgcccgtgacctcgta
ccggacacgtcggtgcgtcccgtgcgggggcagctcgtcgtcgtggagaaccccggcatc
cgcacctggctcgtctccaccggggccgacggggagatggcgtacttcttcccgcagccg
ggccggcttctgctcggcggcacggcggtcgaggacgagtggtccctcgtgcccgatccg
gcggtggccgaggcgatcgtgcggcgctgtgcggcgtggcgacccgagatcgccggggcg
cgggtcctggagcaccggacggggctgcggccggcgcgcggcacggtccggctggaacgc
gaaccgctctcggacggacgggtgttggtgcacaactacggccacggcggcgcgggcgtc
accgtggcctgggggtgcgcccaggaggcggcagggctggccgcctcctggtga

DBGET integrated database retrieval system