KEGG   Streptomyces avermitilis: SAV_1760Help
Entry
SAV_1760          CDS       T00126                                 

Gene name
bga4
Definition
(RefSeq) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sma  Streptomyces avermitilis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SAV_1760 (bga4)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SAV_1760 (bga4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAV_1760 (bga4)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SAV_1760 (bga4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2145008..2147932
Genome map
AA seq 974 aa AA seqDB search
MSRDPLIALRPWESPEVTSWGRLPMNAVDRRTGALPLDGEWRFQLLPTPGSPVTEAWSSQ
HVPGAWTVQGTDDLPQYTNVTMPWGEFPPASPAANPTGVYEREVDVPAEWAGRRVVLRVG
AAESVLLVHVNGRPTGISKDSHLAAEFDLSDVVRPGERATVRLTVVKWSDASHLEDQDHW
WHGGITRSVLLYATDPLHLADVTVRARPDGGLRVDCRVRHAMGRLPGGWYVTGELAGHLL
AQDAEFDRLNAQDERVSDFLGEARLTALVREVRPWTAETPELYELTVRLHRADGSVADTA
HPRVGFRQVEIRGRDLLVNGERVYIRGVNRHDFHPLTGRTVSYDDMRADLVTLKRFGFNA
IRTAHYPNDPALLDLADELGFYVVDEADIESHDHAHEIADDPRYTAAFVDRVSRMVLRDK
NHPSVIVWSLGNESDYGANHDAAAGWVRRHDPTRPLQYEGAAKLGWADPTVASDIACPMY
APVEDCVAHALSGEQTKPLIQCEYSHAMGNSNGTLADHWAAIESTPGLQGGFIWEFWDHG
ILQRVNDGRPAGRAGAGLYDNGVAAQGHRWAYGGDFGETVHDGAFIADGVVFPDRTPKPV
MYEHREIAAPVRLAYDGGDLRISNHQHFRGLEWLAASWELSLAEGGTLTAPAGLPDVRAG
ESAVVPMPFALPEDGGEAWLTLRVTTADDEAWAPRGTEVCVPRVRLRAAAPVASAPLTTG
APVQVDEDGLLVHPLLTAAPVLSLWRAPTDNDEIGGMAARWRAWGLDALERKVVDVRRAA
GSVTVVAEYGTMAGAVRHEQVFTRVEGGVRVEETAELPAGLDDVARVGSVFETVAGLDVL
EWYGQGPWESYPDRSGGAPVGHHSRPVDELFTPYLRPQESGGRHGVRRFTLSAPDATGFA
VELDEPRQVNVTRYRAADLAAATHHDELVPRPGCVVHLDVAHRGLGTASCGPDTSPGHLV
PTGTHRWSWTLRVL
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcgatccgctgatcgcgctccgcccctgggagtcacccgaggtgacctcctgg
gggcggctgccgatgaacgccgtcgaccgccgcaccggggcgctcccgctggacggcgag
tggcgcttccagctgctgcccacgcccggctcacccgtgaccgaagcgtggtcgtcacag
catgtccccggcgcctggaccgtgcagggcaccgacgacctgccgcagtacaccaacgtc
acgatgccctggggagagttcccgcccgcctcgcccgccgcgaacccgacgggcgtgtac
gagcgcgaggtggacgtcccggccgagtgggccggacgccgggtcgtgctccgggtgggc
gccgcggagagcgtgctgctcgtccacgtgaacgggcggccgacgggcatctccaaggac
tcgcacctcgcggccgagttcgatctctcggacgtcgtacgtcccggggagcgggccacc
gtacggctcaccgtggtgaagtggtcggacgcctcgcacctcgaggaccaggaccactgg
tggcacggcgggatcacccggtcggtgctgctgtacgcgaccgatccactgcatctcgcg
gacgtgaccgtgcgggcgcgcccggacggcgggctgcgggtcgactgccgggtgcggcac
gccatgggccggctccccgggggctggtacgtcaccggggagctggcgggccacctcctc
gcccaggacgccgagttcgaccggctgaacgcgcaggacgagcgggtctccgacttcctc
ggcgaggcccgcctcaccgcgctcgtgcgcgaggtgcgcccctggaccgccgagacgccc
gagctgtacgagctgacggtgcgcctgcaccgcgccgacggctcggtcgccgacaccgcg
cacccgcgcgtcggcttccgccaggtcgagatccgcggccgggacctcctggtgaacggc
gagcgggtctacatccggggcgtcaaccggcacgacttccatccgctgacgggccggacg
gtgtcgtacgacgacatgcgcgccgacctcgtcacgctcaagcggttcggcttcaacgcg
atccgcaccgcgcactaccccaacgacccggctctgctcgacctcgccgacgagctgggc
ttctacgtcgtcgacgaggcggacatcgagtcgcacgaccacgcccacgagatcgccgac
gacccgcgctacacggcggccttcgtggaccgcgtctcccgcatggtgctgcgcgacaag
aaccacccctcggtcatcgtctggtcgctgggcaacgagtccgactacggcgcgaaccac
gacgcggcggcgggctgggtccgccgccacgacccgacccgcccgctccagtacgagggc
gcggccaagctcggctgggccgatccgacggtcgcctccgacatcgcctgcccgatgtac
gcgccggtcgaggactgtgtcgcccacgcgctgtccggcgagcagaccaagccgctcatc
cagtgcgagtactcccacgccatgggcaacagcaacggcacgctggccgaccactgggcc
gccatcgagtccaccccgggtcttcagggcggtttcatctgggagttctgggaccacggc
attctgcaacgcgtgaacgacggaagaccggccgggcgcgccggcgccgggctgtatgac
aacggtgtcgcggcgcagggccaccgctgggcctacggcggcgacttcggcgagacggtc
cacgacggcgcgttcatcgccgacggggtcgtctttcccgaccgcacgcccaagccggtg
atgtacgagcaccgggagatcgcggcgccggtgcggctcgcgtacgacggcggtgacctg
cggatctccaaccaccagcacttccggggcctggagtggctggccgcctcgtgggagctg
tcgctcgcggagggcggcacgctgaccgcgcccgccgggctgcccgacgtacgggcgggt
gagtcggccgtggtgccgatgccgttcgccctgccggaggacggcggcgaggcctggctg
acgctgcgggtgacgacggccgacgacgaggcgtgggcgccgcggggcacggaggtatgt
gtgccgcgggtgcggctgcgggcggctgccccggtggcttccgcgccgctgacgacgggc
gctcccgtccaggtcgacgaggacgggctgctcgtccatccgctgctcacggccgccccg
gtgctgtcgctgtggcgggcaccgaccgacaacgacgagatcggcggcatggcggcgcgc
tggcgggcctggggactcgacgcgctcgaacgcaaggtcgtcgatgtacgccgtgcggcc
ggcagcgtcacggtggtcgccgagtacgggaccatggcgggtgccgtgcggcacgagcag
gtgttcacgcgcgtcgagggcggggtgcgggtcgaggagacggccgagctgccggccggg
ctcgacgacgtggcacgcgtgggctcggtgttcgagaccgtcgcggggctcgatgtcctc
gagtggtacgggcagggcccctgggagtcctatccggaccggagcgggggcgcccccgtc
ggccaccactcccgccccgtggacgagctgttcactccgtatctgcgtccgcaggagagc
ggcgggcggcacggtgtacgccggttcacgctctcggcgccggacgccacgggcttcgcg
gtcgagctggacgaaccgcgccaggtgaacgtgacccggtaccgggccgcggacctggcc
gccgccacccaccacgacgagctggtgccgcggcccggctgtgtggtgcacctcgacgtc
gcgcaccgcggcctgggtacggcctcctgcggtcccgacacctcacccggccacctcgtc
ccgaccggcacacatcgctggtcctggacgctgcgcgtgctctga

DBGET integrated database retrieval system