KEGG   Streptomyces avermitilis: SAV_2000Help
Entry
SAV_2000          CDS       T00126                                 

Gene name
aceB1
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sma  Streptomyces avermitilis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_2000 (aceB1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAV_2000 (aceB1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAV_2000 (aceB1)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SAV_2000 (aceB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2439019..2440644
Genome map
AA seq 541 aa AA seqDB search
MSAPAPSPLALVDAEPLPRQEEVLTDAALAFVAELHRLFTPRRDELLARRAQRRAEIART
STLDFLPETAAVRADESWKVAPAPAALNDRRVEITGPTDRKMTINALNSGARVWLADFED
ASAPTWENVVVGQLNLTDAYTRNIDFTDPKSGKSYALKANEELATVVMRPRGWHLNERHL
VDSQGRPVPGALVDFGLYFFHNARRLLDLGKGPYFYLPKTESHLEARLWNDVFVFAQDYV
GIPQGTVRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGAKFVL
PDRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDEEVNKVAFEKVKADKD
REAGDGFDGSWVAHPDLVPIAMASFDAVLGDKPNQKDRLREDVSVAPGDLIAIDSLEAKP
TYNGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVEFENGEK
ATPELARKVAAEELANLRAELGEEAFAAGNWQQAHDLLLKVALDEDYADFLTLPAYEQLA
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccccgctggccctcgtcgacgccgagcccctgccccggcag
gaagaggtcctcaccgacgcggccctcgccttcgtggccgagctgcaccggctgttcacg
ccccggcgtgacgagctcctcgcccgtcgcgcgcagcgccgcgccgagatcgcccgcacc
tccacgctcgacttcctcccggagaccgccgccgtccgcgcggacgagtcctggaaggtg
gcccccgcgccggccgcgctgaacgaccgccgcgtcgagatcaccggccccaccgaccgc
aagatgaccatcaacgccctcaactccggcgcgagggtgtggctcgcggacttcgaggac
gcctccgcgcccacctgggagaacgtggtcgtcgggcagctcaacctgacggacgcgtac
acgcggaacatcgacttcacggacccgaagtccggcaagtcgtacgccctcaaggcgaat
gaggagctggcgaccgtcgtcatgcggccgcgcggctggcacctgaacgagcgtcatctc
gtcgactcgcagggcaggcccgtcccgggcgcgctcgtcgacttcggcctgtacttcttc
cacaacgcgcggcgcctgctggacctcggcaagggcccgtacttctacctccccaagacg
gagtcgcacctggaggcccgcctctggaacgacgtcttcgtcttcgcgcaggactacgtc
ggcatcccgcagggcacggtccgcgccaccgtcctgatcgagacgatcacggccgcgtac
gagatggaggagatcctctacgaactccgcgaccacgcctccgggttgaacgcgggccgc
tgggactacctgttctccatcgtcaagaacttccgtgacggcggcgccaagttcgtcctg
ccggaccgcaacgcggtcacgatgacggccccgttcatgcgcgcctacaccgaacttttg
gtccgcacctgccacaagcgcggcgcgcacgcgatcggcggcatggcggcgttcatcccg
tcccggcgcgacgaagaggtcaacaaggtcgccttcgagaaggtcaaggccgacaaggac
cgcgaggcgggcgacggcttcgacggctcctgggtcgcgcaccccgacctcgtcccgatc
gcgatggcgtccttcgacgcggtgctcggcgacaagccgaaccagaaggaccgcctccgc
gaggacgtgtccgtggcgcccggcgacctgatcgccatcgactccctggaggccaagccg
acgtacaacgggctggtcaacgccgtgcaggtcggtatccgctacatcgaggcctggctg
cgcggcctcggcgcggtcgccatcttcaacctcatggaggacgcggccacggcggagatc
tcacgttcgcagatctggcagtggatcaacgcgggcgtcgagttcgagaacggcgagaag
gccactcccgagctggcccgcaaggtcgccgccgaggaactcgcgaacctccgcgccgaa
ctcggcgaggaggccttcgcggccgggaactggcagcaggcccacgacctgctgctgaag
gtggcgctggacgaggactacgcggacttcctcaccctgcccgcgtacgaacagctcgcc
ggctga

DBGET integrated database retrieval system