KEGG   Streptomyces avermitilis: SAV_2004Help
Entry
SAV_2004          CDS       T00126                                 

Definition
iron transport protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAV_2004
   00240 Pyrimidine metabolism
    SAV_2004
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SAV_2004
   03430 Mismatch repair
    SAV_2004
   03440 Homologous recombination
    SAV_2004
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAV_2004
DNA replication proteins [BR:sma03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAV_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2443486..2444994
Genome map
AA seq 502 aa AA seqDB search
MHRPATAESELAAELDAVRPGLSAPYAAALPGARAAVLTRLWRALAHEPLPWIAHREPEP
GGLTLRLADGRRLHGPPSDPYATAPYVTGVRLDETSYAHPARLVSALGVPHGPALAAELD
HSVASLALSRAGQPRVDPKSPTTSWEWEQRVVDGHPFHPNCRSRPGFSAAEQLAYGPEHR
PVVRLGLVAVEECLVRGEWPKWLRDGERVLIPVHPWQTAHVLDAPVEDGPAAHPLMSLRT
LALRDGGPDVKTALSARLTSSVRDISVYSIETSATVSEFAEAFAARTDGLLHITRTLGAA
TAGRPELAAVVRESPDTYADAEAAERVVPVASLTGTGLPGSPAWLAEFTRLTLTVGLRLL
DLGVALEAHGQNLLVVLSATGAPLRLVYRDLADIRVSPARLARHGVPLPDLGGRLVTDDE
TTLRRKLFGSLVAGALAATAGSGPALREALAAAARDLPRTPDLTALLEEPLPAKALTLMR
LSPDRPGDSWAQLPNPLVTRAF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgtcccgccaccgcagagtccgagctcgccgccgagctcgacgccgtacggccc
ggcctgtcggcgccgtacgcggccgcgctcccgggcgcccgtgcggccgtcctgacccgg
ctgtggcgggcgctggcccatgagccgctgccgtggatcgcgcaccgggagccggagccc
ggcggactcacgctgcggctggccgacggacgccggctgcacggcccgccctcggacccg
tacgcgaccgctccgtacgtcaccggcgtgcggctcgacgagacgtcgtacgcgcatccg
gcccggctggtgtcggcgctcggcgtcccgcacggcccggccctggccgccgaactcgac
cacagtgtcgcctcgttggccctgtcgcgggccggtcagccgcgggtcgacccgaagtcg
ccgacgacgagctgggagtgggaacagcgggtggtcgacgggcatccgttccaccccaac
tgccgttcccggcccggcttttcggccgccgagcagctcgcttacgggcccgagcaccgg
ccggtggtgcggctgggcctcgtggccgtggaggagtgtctcgtccggggcgagtggccc
aagtggctgcgggacggggagcgcgtgctgattccggtccacccctggcagacggcacac
gtgctcgacgcaccggtggaggacgggccggccgcccacccgctgatgtccttgcggacc
ctcgcgctccgcgacggcggcccggacgtcaagaccgcgctcagcgcccggctgacatcg
tccgtgcgggacatctccgtgtactcgatcgagacgtccgcgacggtgtcggagttcgcc
gaggccttcgccgcccgcacggacggcctgctgcacatcacccgcaccctgggcgcggcc
acggccggccggcccgagctggccgcggtggtacgcgagtccccggacacgtacgccgac
gcggaggcggcggaacgtgtcgttccggtggcctcgctcaccggtaccgggctgcccggc
tctcccgcgtggctcgccgagttcacccggctcacgctcaccgtgggtctgcggctgctc
gacctgggcgtggccctggaggcgcacggccagaacctcctggtggtcctgtccgccacg
ggtgccccgctgcgcctcgtgtaccgcgacctcgccgacatccgcgtcagcccggcccgg
ctggcccggcacggtgtcccgctcccggatctcggcgggcgtctcgtcacggacgacgaa
accaccctgcgccgcaaactgttcggctccctcgtcgcgggcgcgctggcggcgacggcg
gggtcggggccggcgctgcgggaggcgctcgccgccgcggcgcgggatctgccgcgcacc
cccgatctgacggcgctgctcgaagagccgctgccggccaaggcgttgacgctgatgcgg
ctgtcgcccgaccggccgggggacagctgggcacagctgcccaacccgctcgtcacgcgc
gcgttctga

DBGET integrated database retrieval system