KEGG   Streptomyces avermitilis: SAV_2004Help
Entry
SAV_2004          CDS       T00126                                 

Definition
iron transport protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sma00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sma00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sma03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sma03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sma03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2443486..2444994
Genome map
AA seq 502 aa AA seqDB search
MHRPATAESELAAELDAVRPGLSAPYAAALPGARAAVLTRLWRALAHEPLPWIAHREPEP
GGLTLRLADGRRLHGPPSDPYATAPYVTGVRLDETSYAHPARLVSALGVPHGPALAAELD
HSVASLALSRAGQPRVDPKSPTTSWEWEQRVVDGHPFHPNCRSRPGFSAAEQLAYGPEHR
PVVRLGLVAVEECLVRGEWPKWLRDGERVLIPVHPWQTAHVLDAPVEDGPAAHPLMSLRT
LALRDGGPDVKTALSARLTSSVRDISVYSIETSATVSEFAEAFAARTDGLLHITRTLGAA
TAGRPELAAVVRESPDTYADAEAAERVVPVASLTGTGLPGSPAWLAEFTRLTLTVGLRLL
DLGVALEAHGQNLLVVLSATGAPLRLVYRDLADIRVSPARLARHGVPLPDLGGRLVTDDE
TTLRRKLFGSLVAGALAATAGSGPALREALAAAARDLPRTPDLTALLEEPLPAKALTLMR
LSPDRPGDSWAQLPNPLVTRAF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgtcccgccaccgcagagtccgagctcgccgccgagctcgacgccgtacggccc
ggcctgtcggcgccgtacgcggccgcgctcccgggcgcccgtgcggccgtcctgacccgg
ctgtggcgggcgctggcccatgagccgctgccgtggatcgcgcaccgggagccggagccc
ggcggactcacgctgcggctggccgacggacgccggctgcacggcccgccctcggacccg
tacgcgaccgctccgtacgtcaccggcgtgcggctcgacgagacgtcgtacgcgcatccg
gcccggctggtgtcggcgctcggcgtcccgcacggcccggccctggccgccgaactcgac
cacagtgtcgcctcgttggccctgtcgcgggccggtcagccgcgggtcgacccgaagtcg
ccgacgacgagctgggagtgggaacagcgggtggtcgacgggcatccgttccaccccaac
tgccgttcccggcccggcttttcggccgccgagcagctcgcttacgggcccgagcaccgg
ccggtggtgcggctgggcctcgtggccgtggaggagtgtctcgtccggggcgagtggccc
aagtggctgcgggacggggagcgcgtgctgattccggtccacccctggcagacggcacac
gtgctcgacgcaccggtggaggacgggccggccgcccacccgctgatgtccttgcggacc
ctcgcgctccgcgacggcggcccggacgtcaagaccgcgctcagcgcccggctgacatcg
tccgtgcgggacatctccgtgtactcgatcgagacgtccgcgacggtgtcggagttcgcc
gaggccttcgccgcccgcacggacggcctgctgcacatcacccgcaccctgggcgcggcc
acggccggccggcccgagctggccgcggtggtacgcgagtccccggacacgtacgccgac
gcggaggcggcggaacgtgtcgttccggtggcctcgctcaccggtaccgggctgcccggc
tctcccgcgtggctcgccgagttcacccggctcacgctcaccgtgggtctgcggctgctc
gacctgggcgtggccctggaggcgcacggccagaacctcctggtggtcctgtccgccacg
ggtgccccgctgcgcctcgtgtaccgcgacctcgccgacatccgcgtcagcccggcccgg
ctggcccggcacggtgtcccgctcccggatctcggcgggcgtctcgtcacggacgacgaa
accaccctgcgccgcaaactgttcggctccctcgtcgcgggcgcgctggcggcgacggcg
gggtcggggccggcgctgcgggaggcgctcgccgccgcggcgcgggatctgccgcgcacc
cccgatctgacggcgctgctcgaagagccgctgccggccaaggcgttgacgctgatgcgg
ctgtcgcccgaccggccgggggacagctgggcacagctgcccaacccgctcgtcacgcgc
gcgttctga

DBGET integrated database retrieval system