KEGG   Streptomyces avermitilis: SAV_2018Help
Entry
SAV_2018          CDS       T00126                                 

Gene name
pucL
Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAV_2018 (pucL)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SAV_2018 (pucL)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SAV_2018 (pucL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2460041..2460988)
Genome map
AA seq 315 aa AA seqDB search
MTDDSRPGRPVMLGQNQYGKAENRVVKITRDGATHHIKDLNVSVALSGDMDEVHYSGSNA
NVLPTDTTKNTVYAFAKEHGIESAEQFGIHLARHFVTSQEPIKTARIRIEEYTWERIEAS
DANSRFIGADEVKHSFVRKGQETRVTQITYDGSSWEVISGLKDLVVMNSTNSEFWGYVKD
KYTTLPEAYDRILATQVAARWRFNWSDDERKMPHWEKSYEQTRKHMLQAFAETYSLSLQQ
TLYQMGSRIINHRSEIDEVRFSLPNKHHFLVDLEPFGLKNDNEVYFAADRPYGLIEATVL
RDGCEAKIPVDLTNL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgattcccgccccggccgccctgtgatgctgggccagaaccagtacggcaag
gccgagaaccgagtcgtgaagatcacgcgggacggcgccacccaccacatcaaggacctg
aacgtctccgtcgcgctctccggcgacatggacgaggtccactactccggctcgaacgcc
aacgtcctgccgaccgacaccaccaagaacacggtgtacgcgttcgccaaggagcacggc
atcgagtccgccgagcagttcggcatccacctcgcccggcacttcgtgacgagccaggag
ccgatcaagaccgcgcgtatccgcatcgaggagtacacctgggagcggatcgaggcctcc
gacgccaactccaggttcatcggcgccgacgaggtcaagcactccttcgtccgcaagggc
caggagacccgcgtcacccagatcacctacgacggctcgtcctgggaggtcatctccggc
ctcaaggacctcgtcgtgatgaactcgaccaactccgagttctggggctacgtcaaggac
aagtacacgacgctccccgaggcgtacgaccgtatcctcgccacccaggtcgctgcccgc
tggcgcttcaactggtctgacgacgagcggaagatgccccactgggagaagtcctacgag
cagaccaggaagcacatgctccaggccttcgccgagacgtactccctctccctccagcag
accctgtaccagatgggttcgcggatcatcaaccaccgcagcgagatcgacgaggtccgc
ttctcgcttccgaacaagcaccacttcctggtggacctggagccgttcgggctcaagaac
gacaatgaggtgtacttcgccgccgaccggccctacggcctgatcgaggcgaccgtcctg
cgggacggctgcgaggcgaagatcccggtggacctcaccaacctctga

DBGET integrated database retrieval system