KEGG   Streptomyces avermitilis: SAV_2031Help
Entry
SAV_2031          CDS       T00126                                 

Gene name
acsA4
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sma01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sma00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sma00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sma00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2473902..2475581)
Genome map
AA seq 559 aa AA seqDB search
MTANTSATDAFRAARDFLLTHREDYATAYEGFRWPRPEHFNWALDWFDVLARGNDRTALH
LVEEDGATTRLSFAELSERSDRVANWLRARGVRAEDRVLVMLGNQAELWETALAAMKLRA
VVIPATPLLGPADLRDRVERGRVRHVVVRAEDTGKFDEVPGRYTRITVGGERPGWQSYEE
AYAADAAFEPDGITHADDPLMLYFTSGTTAHPKLVEHTHVSYPIGHLATMYWIGLEPGDV
HLNISSPGWAKHAWSNLFAPWNAEATVFLHNYTRFDAGRLLTEMDRAGVTTFCAPPTVWR
MLIQADLTQLRTPPREAVAAGEPLNPEVIEQVRRAWGVTIRDGFGQTETAVQVSNSPGQK
LKTGSMGRPSPGFHVELLDPVSGAPGVDEGEIALDLSARPVGLMTGYHGDADRTAEAMAG
GYYRTGDIGSRDADGYITFVGRRDEIFKASDYKISPFELESALLEHEAVAEAAVVPAPDE
LRLAVPKAYIVLAAGFEPGPDTAKVLFEHARSVLAPYQRIRRLEFGELPKTVSGKIRRIE
LREATAAGSAEEYREEDFR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaacacgagcgcgacggacgcattcagggccgcgcgggacttcctgctgacg
caccgcgaggactacgccacggcctacgagggcttccgctggccccgcccggagcacttc
aactgggcgctcgactggttcgacgtcctcgcgcggggcaacgaccgcacggccctgcac
ctcgtcgaggaggacggcgccaccacccggctgtccttcgccgagctgtccgagcgctcc
gaccgcgtcgccaactggctgcgcgcgcggggagtccgggcggaggaccgcgtcctggtc
atgctcggcaaccaggcggagctgtgggagacggcgctggccgcgatgaagctgcgcgcc
gtcgtcatccccgccaccccgctgctgggccccgccgacctgcgcgaccgcgtcgagcgg
ggacgcgtccggcacgtcgtggtgcgcgccgaggacaccggcaagttcgacgaggtgccc
ggccgttacacccggatcaccgtcggcggcgagcggcccggctggcagtcgtacgaggag
gcgtacgcggccgacgcggccttcgagccggacggcatcacccatgcggacgatccgctg
atgctgtacttcacctcgggcacgaccgcccaccccaagctggtcgagcacacccatgtg
tcgtacccgatcggccacttggcgacgatgtactggatcggactcgaaccgggcgacgtc
cacctgaacatctcctcgccgggctgggccaagcacgcctggtcgaacctcttcgccccc
tggaacgcggaggcgacggtcttcctgcacaactacacgcgcttcgacgcgggccgtctg
ctgacggagatggaccgcgccggggtgaccaccttctgcgccccgcccaccgtctggcgc
atgctcatccaggccgacctgacccagctgcggaccccgccgcgcgaggcggtggccgcg
ggcgagccgctgaacccagaggtcatcgaacaggtgcggcgcgcctggggcgtcaccatc
cgggacggcttcggacagacggagacggcggtccaggtctccaacagccccgggcagaag
ctgaagacgggctccatggggcggccgagccccgggttccacgtcgaactgctcgacccc
gtgtcgggcgcgccgggagtggacgagggcgagatcgcgctggatctctcggcgcggccc
gtcggtctgatgaccggctaccacggtgacgccgaccgcaccgccgaggcgatggcaggc
ggctactaccggaccggtgacatcggttcgcgcgacgcggacggctacatcacgttcgtg
ggccggcgcgacgagatcttcaaggcctccgactacaagatctccccgttcgagctggag
agcgcgctgctggagcacgaggcggtggcggaggcggccgtggtgcccgcgccggacgag
ctgcggctcgccgtgccgaaggcgtacatcgtcctggcggcgggcttcgagccgggcccc
gacacggcgaaggtgctcttcgagcacgcgcgctcggtcctggcgccgtaccagcgcatc
cgcaggctggagttcggtgaactccccaagaccgtgtccggcaagatccgccggatcgag
ctgcgcgaggccacggcggcgggctcggccgaggagtaccgcgaggaggacttccggtga

DBGET integrated database retrieval system