KEGG   Streptomyces avermitilis: SAV_2044Help
Entry
SAV_2044          CDS       T00126                                 

Gene name
aceB2
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sma  Streptomyces avermitilis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_2044 (aceB2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAV_2044 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SAV_2044 (aceB2)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SAV_2044 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2493411..2495003
Genome map
AA seq 530 aa AA seqDB search
MSTSALTHRVRVLAAPGDRHDEILTPAALDFVGRLVAAFGERRPELLKERRRQAIRLAAG
SALDFPLATAGVRADASWRVAAPAPGLTDRRVEITGPPDRRTAVNALNSKARVWMADFED
ATSPTWDNIIGGQLTLLDAIERRIDFTTPEGKEYRLGDRLATIMVRPRGWHLTEEHLEFD
GRPVPASLVDFGLYFFHCAQRQIDAGHGPYFYLPKLENRYEARLWNDVFVLAQELLGIPP
GTIRATVLIETITAAVEMEEILYELREHSAGLNAGRWDYLFSLIKTFGHRTDFLLPDRAT
VTMTAPFLRAYTELLVRTCHRRGAHAIGGMSAQVPGRDPAAGEAALAKVRLDKEREAEDG
FDGSWVAHPGLVPMCREVFDGVLGERPHQIERTRDDVEVTAADLLSVRRISGPPSPEGVR
TNIAVSLRYFDAWLRGRGAVALYGLMEDAATAEIARVQIWQWLRHRVVDRDTVVRLLDDE
LAALGAEYPWAALDEVRALFERTALAAELPLFFTPDAYTRHLVRHAEARS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccagcgcactgacacaccgcgtccgggtcctcgcggcaccgggcgaccgccac
gacgagatcctgacacccgccgccctggacttcgtcggccgcctcgtcgcggccttcggc
gagcggcgcccggagctgctgaaggagcgcaggcggcaggcgatacggctcgcggccgga
tccgcgctcgacttccccctcgccaccgccggtgtccgggcggacgcctcgtggcgcgtg
gccgcaccggcccccggcctgaccgaccggcgggtggagatcaccggcccgcccgaccgc
cgtacggccgtcaacgcgctcaactccaaagcgcgggtgtggatggcggacttcgaggac
gccacctcccccacctgggacaacatcatcggcggccagctcacgctgctcgacgccatc
gagcggcggatcgacttcaccacaccggagggcaaggagtaccggttgggtgaccggctc
gccaccatcatggtccgcccccggggctggcacctgacggaggaacacctggagttcgac
ggccggcccgtacccgcctccctcgtcgacttcggcctgtacttcttccactgcgcgcag
cgccagatcgacgccggacacggaccgtacttctacctgccgaagctggagaacagatac
gaagcccgcctgtggaacgacgtcttcgtcctcgcccaggagctgctcggcatccccccg
gggaccatccgggcgaccgtgctcatcgagacgatcaccgccgccgtggagatggaggag
atcctctacgagctgcgcgaacacagcgccggcctcaacgcgggacgctgggactatctc
ttcagcttgatcaagaccttcgggcaccgcaccgacttcctgctgcccgaccgggccacg
gtgaccatgaccgcacccttcctgcgcgcctacaccgaactgctggtgcgcacttgccac
cggcgcggcgcccacgccatcggcggcatgtccgcgcaggtgcccggcagggatccggcc
gcgggcgaggcggccctggcgaaggtccggctggacaaggagcgcgaggcggaggacggc
ttcgacggctcctgggtggcccaccccggcctggtgcccatgtgccgcgaggtcttcgac
ggtgtcctcggcgagcggccgcaccagatcgagcgcacccgggacgacgtggaggtgacc
gccgcggacctgctgtcggtgcggcgcatcagcggaccgccctcgccggaaggggtccgt
accaacatcgcggtctcgctgcgctacttcgacgcctggctgcgcgggcggggggccgtc
gccctgtacggcctgatggaggacgcggcgaccgcggagatcgcccgcgtgcagatctgg
cagtggctgcggcaccgggtcgtcgaccgggataccgtggtgcggctgctcgacgacgaa
ctcgccgccctgggcgcggagtacccctgggcggccctcgacgaggtgcgtgcccttttc
gaacgaacggcgctggccgccgagttgccgctgttcttcaccccggacgcctacacccgt
cacctcgtccggcacgcggaggcgcggtcatga

DBGET integrated database retrieval system