KEGG   Streptomyces avermitilis: SAV_2044Help
Entry
SAV_2044          CDS       T00126                                 

Gene name
aceB2
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sma  Streptomyces avermitilis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_2044 (aceB2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAV_2044 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SAV_2044 (aceB2)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SAV_2044 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2493411..2495003
Genome map
AA seq 530 aa AA seqDB search
MSTSALTHRVRVLAAPGDRHDEILTPAALDFVGRLVAAFGERRPELLKERRRQAIRLAAG
SALDFPLATAGVRADASWRVAAPAPGLTDRRVEITGPPDRRTAVNALNSKARVWMADFED
ATSPTWDNIIGGQLTLLDAIERRIDFTTPEGKEYRLGDRLATIMVRPRGWHLTEEHLEFD
GRPVPASLVDFGLYFFHCAQRQIDAGHGPYFYLPKLENRYEARLWNDVFVLAQELLGIPP
GTIRATVLIETITAAVEMEEILYELREHSAGLNAGRWDYLFSLIKTFGHRTDFLLPDRAT
VTMTAPFLRAYTELLVRTCHRRGAHAIGGMSAQVPGRDPAAGEAALAKVRLDKEREAEDG
FDGSWVAHPGLVPMCREVFDGVLGERPHQIERTRDDVEVTAADLLSVRRISGPPSPEGVR
TNIAVSLRYFDAWLRGRGAVALYGLMEDAATAEIARVQIWQWLRHRVVDRDTVVRLLDDE
LAALGAEYPWAALDEVRALFERTALAAELPLFFTPDAYTRHLVRHAEARS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccagcgcactgacacaccgcgtccgggtcctcgcggcaccgggcgaccgccac
gacgagatcctgacacccgccgccctggacttcgtcggccgcctcgtcgcggccttcggc
gagcggcgcccggagctgctgaaggagcgcaggcggcaggcgatacggctcgcggccgga
tccgcgctcgacttccccctcgccaccgccggtgtccgggcggacgcctcgtggcgcgtg
gccgcaccggcccccggcctgaccgaccggcgggtggagatcaccggcccgcccgaccgc
cgtacggccgtcaacgcgctcaactccaaagcgcgggtgtggatggcggacttcgaggac
gccacctcccccacctgggacaacatcatcggcggccagctcacgctgctcgacgccatc
gagcggcggatcgacttcaccacaccggagggcaaggagtaccggttgggtgaccggctc
gccaccatcatggtccgcccccggggctggcacctgacggaggaacacctggagttcgac
ggccggcccgtacccgcctccctcgtcgacttcggcctgtacttcttccactgcgcgcag
cgccagatcgacgccggacacggaccgtacttctacctgccgaagctggagaacagatac
gaagcccgcctgtggaacgacgtcttcgtcctcgcccaggagctgctcggcatccccccg
gggaccatccgggcgaccgtgctcatcgagacgatcaccgccgccgtggagatggaggag
atcctctacgagctgcgcgaacacagcgccggcctcaacgcgggacgctgggactatctc
ttcagcttgatcaagaccttcgggcaccgcaccgacttcctgctgcccgaccgggccacg
gtgaccatgaccgcacccttcctgcgcgcctacaccgaactgctggtgcgcacttgccac
cggcgcggcgcccacgccatcggcggcatgtccgcgcaggtgcccggcagggatccggcc
gcgggcgaggcggccctggcgaaggtccggctggacaaggagcgcgaggcggaggacggc
ttcgacggctcctgggtggcccaccccggcctggtgcccatgtgccgcgaggtcttcgac
ggtgtcctcggcgagcggccgcaccagatcgagcgcacccgggacgacgtggaggtgacc
gccgcggacctgctgtcggtgcggcgcatcagcggaccgccctcgccggaaggggtccgt
accaacatcgcggtctcgctgcgctacttcgacgcctggctgcgcgggcggggggccgtc
gccctgtacggcctgatggaggacgcggcgaccgcggagatcgcccgcgtgcagatctgg
cagtggctgcggcaccgggtcgtcgaccgggataccgtggtgcggctgctcgacgacgaa
ctcgccgccctgggcgcggagtacccctgggcggccctcgacgaggtgcgtgcccttttc
gaacgaacggcgctggccgccgagttgccgctgttcttcaccccggacgcctacacccgt
cacctcgtccggcacgcggaggcgcggtcatga

DBGET integrated database retrieval system