KEGG   Streptomyces avermitilis: SAV_2096Help
Entry
SAV_2096          CDS       T00126                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sma  Streptomyces avermitilis
Brite
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SAV_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2557028..2558104
Genome map
AA seq 358 aa AA seqDB search
MPHTTAAHRRRASRPLPLVAVGALVAAAVALPQLTPDAFAATTLRGYADGRGVRIGAAVG
DSPLRSDSAYTTALDREFNSVTAENAMKWDAVEPSRGGFDWAAADRLVAHASAHGQGVRG
HTLAWYAQLPSWLKNGNFSASELNTILKSHIDTEVGRYKGKVYAWDVVNETFNEDGSMRG
SLWQDKLGTGYIANALRWAHAADPAAKLYINDYNIEADNAKSDALYALAKQLLADGVPLH
GIGFQSHFVVGQVPSTMKANLKRFSDLGLEVSVTELDIRIPLPASSDELAQQSADYKTAS
ENCLGVARCAGITVWGVSDKYSWIPGTFSGYGAALPYNESYAAKPAYTGLSNGLDPTA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgccccacacaacagccgcccaccgtcgtcgcgcctcccgtcccctccccctcgtagcc
gtcggcgcgctggtcgccgccgccgtcgccctcccccagctcaccccggacgcctttgcc
gccaccaccctccggggctacgccgacggccgcggcgtgcggatcggtgcggccgtcggc
gacagcccgttgcggagcgactcggcgtacaccaccgcgctggaccgggagttcaactcc
gtcaccgccgagaacgcgatgaagtgggacgcggtggagcccagccggggcggcttcgac
tgggccgccgccgaccggctcgtcgcgcacgcgagcgcacacggccagggagtacgcggg
cacaccctggcctggtacgcacagctgccgtcgtggctgaagaacggcaacttctcggcc
tccgagctgaacacgatcctcaagagccacatcgacaccgaggtcggccgctacaagggc
aaggtgtacgcctgggacgtggtcaacgagacgttcaacgaggacggctcgatgcgcggt
tcgctgtggcaggacaagctcgggaccgggtacatcgcgaacgcgctgcggtgggcgcac
gccgccgaccccgccgccaagctgtacatcaacgactacaacatcgaggcggacaacgcg
aagagcgacgccctgtacgcgctggcgaagcaactcctggcggacggggtgccgttgcac
ggcatagggttccagtcccacttcgtggtcgggcaggtgccgtccaccatgaaggccaat
ctcaagcgcttctcggacctggggctcgaggtctccgtcaccgaactcgacatccgcatc
cccctgcccgcctcctccgacgaactggctcagcagtccgccgactacaagacggccagc
gagaactgcctgggtgtcgcgcgctgcgcgggcatcaccgtgtggggcgtcagcgacaag
tactcatggatcccggggacgttcagcgggtacggcgcggccctcccgtacaacgagagc
tacgcggcgaagcccgcctacaccgggctgtcgaacggactcgatccgaccgcgtga

DBGET integrated database retrieval system