KEGG   Streptomyces avermitilis: SAV_2223Help
Entry
SAV_2223          CDS       T00126                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sma  Streptomyces avermitilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAV_2223
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SAV_2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2701864..2703288)
Genome map
AA seq 474 aa AA seqDB search
MSTTQTRTGMGQVVVIGGGIAGLAAAHRLLDRGARVTVLEASDRLGGKLLPGEIEGVRVD
LGAESMLARRPEAVGLAREVGLADRLRPPATASASIWTRGALRPMPKGHVMGVPGTASAL
AGVLSDEGLRRIERDADLPRTEVGDDVAVGEYVAARLGREVVDRLVEPLLGGVYAGDAYR
LSMRSAVPQLFTAIHAHASLTEVVRELQEKAAAAQQTGPVFMGIEGGVGQLPLAVAESVR
ARGGEIVTGAPGDRAAQSRGRAGRVGGWSPAVVCCTPTPWSSPCPPRPPPSCCAPRHPPP
RPSWPASSTRPWRWSPSPTAAVGPASPKAAASSCLPSTGAPSRHRRSPPRSGAGSRTRTP
TCWCCARRSGGTARRRSSAGTTPASWTSRATTCARRPAWPPRRSPAASPAGPTACRSTPS
ATTRAWPASATTSPSCPASPSAARRTTASASRPASPARTPPWSSWAATARGWTS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaactcagacgcgcacgggtatggggcaggtcgtcgtcatcgggggcgggatc
gcggggctggccgccgcgcaccggctgctggaccgtggcgcgcgcgtgaccgtgctcgag
gcgtcggaccgcctcggcggcaagctgctgcccggcgagatcgagggcgtccgggtcgac
ctcggcgccgagtcgatgctcgcgcgccgccccgaggcggtgggcctcgcgcgtgaggtg
ggcctcgccgaccgcctccgccccccggccaccgcctcggcgtcgatctggacccgcggc
gccctgcgccccatgcccaagggccacgtcatgggcgtcccgggcacggcgtccgcgctg
gccggcgtgctgagcgacgagggcctgcgccgcatcgagcgcgacgccgacctgccccgc
acggaggtcggcgacgacgtggcggtgggggagtacgtggcggcgcgcctcggccgcgag
gtcgtcgaccgcctggtcgagcccctcctgggcggggtgtacgcgggcgacgcgtaccgc
ctctcgatgcgctcggcggtcccccagctcttcaccgcgatccacgcgcacgcgtcgctg
acggaggtggtccgcgagctccaggagaaggcggccgcggcccagcagacgggcccggtc
ttcatgggcatcgagggcggcgtcgggcaactgccgctcgcggtcgcggagtcggtgcgc
gcgcggggcggcgagatcgtcaccggggcgccgggtgaccgagctgcgcagagccgaggg
cgggccggccgcgtgggtggctggtcgccggcggtcgtgtgctgcacgccgactccgtgg
tcgtcgccctgcccgccgcggccgccgccgagctgctgcgcgccgaggcacccgccgccg
cggccgagctggccggcgtcgagtacgcgtccatggcgctggtcaccctcgcctaccgcc
gcagtgggaccagcctccccgaaggcagcggcttcctcgtgcctcccgtcgacgggcgca
ccatcaaggcatcgacgttcgcctcccagaagtggggctggatcgcggacgaggaccccg
acctgctggtgctgcgcacgtcggtcgggcggtacggcgagacggagatcctcggccggg
acgacgccggcctcgtggacgtctcgcgccacgacctgcgcgaggcgaccggcctggccg
ccacgccggtcgccagccgcgtcacccgctggaccgacggcctgccgcagtaccccgtcg
gccaccacgcgcgcgtggcccgcatccgcgaccacgtcgccaagctgcccggcctcgccg
tctgcggcgcggcgtacgacggcgtcggcatcccggcctgcatcgccggcgcgtacgccg
ccgtggagcagctgggcggcgaccgcgcggggctggacgagctga

DBGET integrated database retrieval system