KEGG   Streptomyces avermitilis: SAV_2312Help
Entry
SAV_2312          CDS       T00126                                 

Gene name
cysC2
Definition
adenylylsulfate kinase
Orthology
K00860  
adenylylsulfate kinase [EC:2.7.1.25]
Organism
sma  Streptomyces avermitilis
Pathway
Purine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sma00920]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sma00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2814750..2815301
Genome map
AA seq 183 aa AA seqDB search
MTTTSRAQGATVWLAGLPSAGKTTIGRILAGRLRSQGHRVEVLDGDEIRRFLSAGLGFSR
ADRHTNAQRIGLVAEVLARNGVLAVVPVIAPYADSREAVRKRHEASGTPYLEVHVATPVE
VCSERDVKGLYARQAAGRLKGLTGVDDPYEPPVDPALTLETQGQTPEESAGAVYAVLAAR
GLV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgtccagggcgcagggagccacggtctggctcgccgggctgccgagcgcg
ggcaagaccaccatcggccgcatactcgccgggcggctgaggtcgcaggggcaccgcgtg
gaggtgctcgacggcgacgagatccgccgtttcctctccgcggggctcggcttctcgcgc
gcggaccgccacaccaatgcgcagcgcatcggcctggtcgccgaggtgctggcgcgcaac
ggcgtcctcgccgtcgtcccggtcatcgcgccgtacgccgacagccgcgaggcggtccgc
aaacggcacgaggcgagtgggacgccgtacctcgaggtgcatgtcgccaccccggtcgag
gtgtgcagcgaacgggacgtgaaagggctgtacgccaggcaggccgcgggccggctgaag
ggtctgaccggtgtcgacgacccgtacgagccgcccgtggacccggcgctcaccctggag
acgcaggggcagacgcccgaggagtcggcgggggccgtgtacgcggtcctggcggcgagg
ggtctcgtatga

DBGET integrated database retrieval system