KEGG   Streptomyces avermitilis: SAV_259Help
Entry
SAV_259           CDS       T00126                                 

Gene name
asnH1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sma  Streptomyces avermitilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sma00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(301142..303052)
Genome map
AA seq 636 aa AA seqDB search
MPAVRLPHLLLTLVEGTGMEFLVLPDHPAGAAALALMPTAGPPPTHVIEHHSGRPWIVGC
WNEEDVMVTAVGPHRVALLGRTTADADVLTRRLRDVRSVRDLDGLAATAAGSFHLVASVN
GEVRVQGTLSAACQIYYATVAGVTLAADRPQALADRIGADIDEDQVALALLSPFGPPWPL
SERSLWRGVCSPPTGHCLEIGRDGTGRTRQWWTAPDPDRPLGNGDMIRQALAEAVATCTA
GQEVVSADLSGGLDSTSLCFLADADRHDAHLVTVHYQALGRSSDDRYWARQAEAALPGAR
HLLVGPGQAPDWYAPLAHAVHDREGPLTFVRSRATTEHLARLAAAHGSRRHLQGIGGDEL
FHPSPMALHALVRRHPLAALPHLRALRSMRRWPLTTTARTLASAPSYTQWLAACSNFPAD
RHDWGAGADWEPLPKLPPWATPHAAATVRRQLLAALAATPQPLATLPVQHEMIRLTRING
NATRRNSHIGAHTGVTFHAPFTDDRVLEAILAVRLEDRVALGQFKPMLGTALRSIVPAGL
LSRTTKGDASAELYAGLRRRRGELLKLMDDSHLVRMGFVDADVLRTVLRGLHADTRPLMP
LDSTLACELWLRTLSPADTARATAVPVPSPRTVKEI
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
gtgccagccgtgcgtcttccccacctcttactcacccttgtggaagggaccggcatggaa
ttcttggtacttcccgaccacccggccggcgctgcggccctggcgctcatgccaactgcc
ggaccgccaccgacgcacgtgattgagcaccactcggggcgaccgtggattgtgggctgc
tggaacgaagaggacgtcatggtcaccgctgtgggcccgcatcgcgtggctctgctcggc
cgcaccaccgcggacgcagacgtcctcacccggcggctgcgcgacgtccggtcggtccgc
gacctcgacggcctagccgcaacagccgctggaagcttccacctcgtggcgtcggtaaac
ggagaggtgcgcgtccagggcacgctctcagcggcgtgtcagatctactacgccacggtc
gccggagtgaccctggccgccgaccgcccccaggcactggccgaccggatcggggccgac
atcgacgaggatcaggtggcactggcactgctctcgcccttcgggccgccgtggcctctg
agcgagcggagcctgtggcgtggcgtgtgctcacccccgaccgggcactgccttgagatc
ggcagggacggcacggggcgtacccgccaatggtggactgcgccggatccggaccgcccc
ctgggcaacggcgacatgatccgacaggcgctggccgaggcggtggcgacctgtaccgcg
ggccaggaggtcgtgagtgccgacctgtccggcggcctggactccaccagcctgtgcttc
ctggccgacgccgaccgccacgacgcccacctggtgacggtccactaccaggcgctgggc
cggtccagcgacgatcggtactgggcccgccaggccgaggccgctttgccgggcgcccgg
caccttctggtcggccccggtcaagccccggactggtacgcgcctctcgcccacgccgtc
catgaccgagaaggccccctgacgttcgtacggtcccgcgcgaccaccgagcacttggcc
cggcttgccgcagcgcacggctcgcgacgtcacctccaaggcattggcggtgacgagctc
ttccaccctagcccgatggctctgcacgccctcgtccgacggcatcctctcgccgccctg
ccacacttgcgcgccctgcgctccatgcgccgctggcccctgactacaaccgcccgtacc
ctcgcctctgcaccctcatacacgcagtggctggccgcctgcagcaacttccctgccgac
aggcacgattggggagccggagcagactgggagccactgccgaaactcccgccctgggcc
accccgcacgccgcggcgaccgtccggcgtcaactcctcgccgccctcgcagccacacct
cagccgctggccaccctgcccgtccagcacgagatgatccggctcacccgcatcaacggc
aatgccacccgccgcaactcccatatcggcgcccataccggcgtcactttccacgcaccc
ttcaccgacgaccgggtcctggaggccattctggcggtacggctggaggaccgggtggcc
ctgggccagttcaagcccatgctcggcacggccctgcgcagcatcgtccccgccggcctg
ctcagccgcacgaccaagggcgacgccagcgccgagctctacgcgggactgcgccgtcgg
cgcggcgagctcctcaagctcatggacgactcccatctggtccgcatgggcttcgtcgac
gccgacgtcctgcgcaccgtcctgcgcggcctgcacgccgacacccggcccctgatgccc
ctggactccaccctcgcctgcgaattgtggctgcgcaccctgtccccggctgacaccgcc
cgggccaccgccgtgcccgttccctcccctcgaaccgtcaaggaaatatga

DBGET integrated database retrieval system