KEGG   Streptomyces avermitilis: SAV_2709Help
Entry
SAV_2709          CDS       T00126                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sma  Streptomyces avermitilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SAV_2709
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAV_2709
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SAV_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3321963..3323906
Genome map
AA seq 647 aa AA seqDB search
MTRVRGRHLLTPRTPHSPTPEGRRAMRRSTRAARLLLAGLLSTAGLTAVSTAPAHAAGEQ
VTAWLTTTDDTGGRHVVRGLQAQTPFAFQSGSGGSGENITVDENTRYQTFTGGGASFTDT
AAWLMNSSGALSATTRNAAMTKLFSPTDGIGLSFLRNPMGASDLARYGYSYDDVPAGQTD
PNLTSFSIAHDLADVVPLTKQALQLNPSLTVMASPWTAPAWMKDSGSLNGGWLKSEDYGA
YANYFVKYLQAYKAQGVNVSYVTAQNEPTCCSGYPSMSWNASGLAYFTKSELLPKLQAAG
LTTKVLAHDWNWDVYDSYAASTVDDAAVRSHPNFGGIAWHGYGGDIAKQTSVHNQYPTLD
AFGTEHSGGTWIANQQREDMSNIIDYTRNWAKSVTKWSLAVDQNMGPHNGGCGTCTGLVT
VHNGDGASGTVDYTVEYYTMGHLTKFVRPGAQRVASTASASVPNVAWRNPDGSKALIAYN
DASTAKTVTLNWGSQHATYSLPGKTSATFTWSGTQSGGGDQTGSFVGLAGKCLDVASSSS
ANGTAVQLYDCNGSTAQRWTVKADGSVQALGKCLDVTSASTADGAKIQLYDCNGTAAQRW
SYNASTGDVVNTAADKCLDVTGNSSANGARAQIWSCTGAANQKWKLQ
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcgcgtccgcggccgtcatttactcacgcctcgcacgccccactcccccacccca
gaagggcgacgcgccatgaggagatccactcgggcggcccggcttctgctcgccgggctg
ctcagcaccgccgggctgaccgccgtctcgaccgcgcccgcgcacgccgcgggcgaacag
gtcaccgcctggctgaccacgacggacgacaccggcggacgccatgtcgtgcgcgggctc
caggcccagacgccgttcgccttccagtccggcagcggcggcagcggcgagaacatcacc
gtggacgagaacacccggtaccagacattcaccggtggcggcgcgtccttcacggacacc
gcggcctggctgatgaacagcagcggggcgctgtccgcgacgacccggaacgcggccatg
accaagttgttctcgccgacggacgggatcgggctgtcgttcctgcgcaatccgatgggc
gcctccgacctggcgcggtacgggtactcgtacgacgacgtgccggccgggcagaccgac
cccaacctgacgagcttctccatcgcgcacgacctcgccgacgtggtgccgctcaccaag
caggcgctccagctcaacccctctctgacggtcatggcctcgccatggacggcgccggcc
tggatgaaggacagcggctcgctcaacgggggctggctgaagtcggaggactacggggcg
tacgccaactacttcgtgaagtaccttcaggcgtacaaggcgcagggcgtcaacgtctcg
tacgtgaccgcgcagaacgagccgacgtgctgctcgggttacccgtcgatgagctggaac
gccagcgggctcgcgtacttcaccaagagcgagctgctgccgaagctccaggcggcgggc
ctgacgaccaaggtcctcgcgcacgactggaactgggacgtctacgactcctacgcggcc
tcgacggtcgacgacgcggcggtgcgttcgcaccccaacttcggcgggatcgcctggcac
ggctacggcggtgacatcgccaagcagacgtccgtgcacaaccagtacccgaccctcgac
gccttcggcaccgagcactccggcggcacctggatcgccaaccagcagcgcgaggacatg
tccaacatcatcgactacacccggaactgggcgaagtcggtgaccaagtggtcgctcgcc
gtggaccagaacatgggcccgcacaacggaggttgcggcacctgcacgggtctggtcacc
gtgcacaacggggacggcgcgagcgggaccgtcgactacacggtcgagtactacacgatg
ggtcacctgacgaagttcgtccgcccgggtgcgcagcgcgtcgcgtcgacggcgagtgcg
tcggtgccgaacgtggcgtggcgcaatccggacggttcgaaggcgctgatcgcgtacaac
gacgcgtcgacggcgaagacggtcaccctcaactggggctcgcagcacgcgacgtactcg
ctgcccggcaagacgtcggcgacgttcacctggtcggggacccagtcgggcggcggcgac
cagacgggctcgttcgtggggctcgcgggcaagtgcctggatgtggcgagcagttcgtcc
gcgaacgggacggcggtgcagctgtacgactgcaacggctcgaccgcccagcgctggacg
gtgaaggccgacggttccgtgcaggccctcggcaagtgcctggacgtcacctcggcctcg
acggccgacggcgcgaagatccagctgtacgactgcaacggcacggcggcccagcgatgg
tcgtacaacgcttcgacgggtgatgtggtcaacacggccgccgacaagtgcctcgacgtg
accggcaactcctcggccaacggcgcccgcgcgcagatctggtcctgcacgggcgccgcc
aaccagaagtggaagctccagtga

DBGET integrated database retrieval system