KEGG   Streptomyces avermitilis: SAV_2917Help
Entry
SAV_2917          CDS       T00126                                 

Gene name
thrC1
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAV_2917 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAV_2917 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAV_2917 (thrC1)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAV_2917 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3650076..3651134)
Genome map
AA seq 352 aa AA seqDB search
MTHQWRGIIEEYRDRLPVSDSTPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGANPTGS
FKDRGMTMAITRAKEEGAKAVICASTGNTSASAAAYAVRAGMVCAVLVPQGKIALGKMGQ
ALVHGAKILQVDGNFDDCLTLARNLSDNYPVALVNSVNPVRIEGQKTAAFEIVDMLGDAP
DIHVLPVGNAGNITAYWKGYQEYAADGIARHKPRMWGFQASGSAPIVRGEVVKDPSTIAT
AIRIGNPASWKFALAAKDESGGFIDEVTDREILRAYRLLAAQEGVFVEPASAASVAGLLK
AAEQGKVDPGQTIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAATAAERLGLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccagtggcgcggaatcatcgaggagtaccgggaccggctgcccgtctccgac
agtacgccggtcgtgacgctccgtgagggcgggacgccgctcgtgcccgcgcaggtgctc
tccgagcgcacgggctgcgaggtccacctcaaggtggagggcgccaaccccaccgggtcc
ttcaaggaccgcggcatgaccatggccatcacgcgggccaaggaggagggcgcgaaggcg
gtcatctgcgcctccaccggcaacacgtcggcctccgccgccgcgtacgccgtacgcgcg
ggcatggtctgcgccgtgctcgtcccgcagggcaagatcgccctcggcaagatgggccag
gccctcgtgcacggcgcgaagatcctccaggtcgatggcaacttcgacgactgcctcacc
ctcgcgcgcaacctgtccgacaactacccggtggcgctggtcaattcggtcaacccggtg
cgtatcgaggggcagaagaccgcggcgttcgagatcgtcgacatgctcggtgacgcgccc
gacatccacgtcctcccggtcggcaacgcgggcaacatcaccgcgtactggaagggctat
caggagtacgccgccgacggcatcgcccgccacaagccccgtatgtggggcttccaggca
tccggctccgccccgatcgtgcgtggcgaggtcgtcaaggacccgtcgaccatcgccacc
gcgatccgtatcggcaacccggcgtcctggaagttcgcgctggcggcgaaggacgaatcc
ggcggtttcatcgacgaggtgacggaccgtgagattctgcgcgcctaccggctgttggcc
gcgcaggagggcgtcttcgtcgagcccgcgtccgccgcgtccgtcgccggtctgctgaag
gccgccgagcagggcaaggtcgacccgggccagaccatcgtctgcacggtcaccggcaac
ggcctcaaggaccccgactgggccgtcgcgggcgctccgcagccggtcacggtcccggtc
gacgcggccacggcggccgagcggctcgggctcgcgtaa

DBGET integrated database retrieval system