KEGG   Streptomyces avermitilis: SAV_3191Help
Entry
SAV_3191          CDS       T00126                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAV_3191 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAV_3191 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAV_3191 (thrC2)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAV_3191 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3973434..3974567
Genome map
AA seq 377 aa AA seqDB search
MTPLPDYFCPADGTRVPGGSLDWCCPACRGPLDLDFAPTPGPLKSLGGRVNSLWRYAECL
PLAAPTTSLGEGRTPLVSLTDGVAAKLDFLMPTLSFKDRGAVLLAELALQLRPRQVVADS
SGNAGTAIAAYCARAALPCTVYVPEGTSAKKLEQIEAHGARLRVVEGDREATAHAAREAA
DEAGVFYASHVFNPYFLHGTKTYVHELWEDLGGRLPDALVVPVGNGTLLLGAALAVAELH
AAGLIDRRPALYAVQAAAVAPLAHAWEQGADDLVGVTPAAPTFAEGIAIPRPPRARQILR
AVRESGGAFLTVTEDQIRHAQSDLASRGLYVESTGVACWAAVRAGALPQPRPRPGEGMPA
AVVPLCGAGLKTGPARA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactcctttgccggattacttctgcccggcggacggcacgcgcgtccccggcggctcc
ctcgactggtgctgccccgcctgccgcgggccgctggacctggacttcgcccccacgccc
gggcccctcaagtccctcggcgggcgcgtgaactcgctgtggcggtacgcggagtgcctg
ccgctcgcggcgccgacgacgagtctcggtgagggccgtaccccgctcgtgtccctgacg
gacggcgtcgcggccaagctcgacttcctgatgccgaccctgtcgttcaaggaccggggc
gcggtgctgctggccgaactggcgctgcagctgcggccccggcaggtcgtcgcggacagc
agcggcaacgcgggtaccgcgatcgccgcgtactgcgcacgggccgccctgccgtgcacg
gtctacgtccccgagggcacgtcagcgaagaagctggagcagatcgaggcgcacggggcc
cggctgcgggtggtcgagggcgaccgcgaggcgacggcgcatgcggcgcgggaggccgcg
gacgaggcgggcgtcttctacgcgtcgcacgtcttcaacccgtacttcctgcacggcacc
aagacctatgtccacgagctctgggaggacctcggcggacggctcccggacgcgctcgtc
gtgcccgtcggcaacggcacgctgctcctcggcgccgcccttgccgtcgccgagctgcac
gcggcgggtctcatcgaccggcggcccgcgctgtacgccgtccaggccgcggcggtcgca
ccgctggcccacgcctgggagcagggcgcggacgacctggtcggggtcaccccggcggcc
cccacgttcgcggagggcatcgcgatcccccgcccgccgcgggcccgtcagatcctgcgg
gcggtacgcgagtccggtggcgccttcctgacggtgacggaggatcagatcaggcacgcg
cagagcgacttggcgtcgcggggactgtacgtcgagtcgacgggcgtggcgtgctgggcg
gccgtgcgcgcgggcgcgctgccccagccccggccgcgtccgggcgagggaatgcccgcg
gcggtcgtaccgctgtgcggggcggggctgaagacgggaccggcgcgggcgtaa

DBGET integrated database retrieval system