KEGG   Streptomyces avermitilis: SAV_3393Help
Entry
SAV_3393          CDS       T00126                                 

Gene name
nagZ2
Definition
beta-N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sma  Streptomyces avermitilis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sma00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sma00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4214726..4216363)
Genome map
AA seq 545 aa AA seqDB search
MSGRRRRVPEGRTPVRRNRLLLGGGLIVAGTLGVTAVLWPSGGSEPAGARASTASSAAAA
TRTPSPSPTRAYPLSKAPRTIPAVREHTAARGPGWRPAKGGRVVVGDAALADEGKLTAGE
LGLAYAGRTGARAGDVELALDKGTGGPESYTLTVRGGRVRIAAPAEAGVFYGTRTLKQAV
HGGGTAPEGVVRDRPAKPRRGLMLDIARKHFTAGWIEDRIRELGDLKYNELGLHFSDDQG
FRIESASHPEIVSRQHLTKAEVRGIVDLAASRHIAVVPEIDSPGHLGAVIAAHPDLQLRN
ASGVPARGAVDISKPAAATIVDDLLNEYADLFPGAYWHLGGDEYQALMVSDPSASYPQLA
AAARNKYGANATVADLTTGWLNGRADNMRAHHRTMRAWNDGFYRSAGTVRPAKDIQVAYW
TGKEIGARQPAEYLSAGRKLINYNDEYLYYVLGQPQTFVYPTGQRIYQQWTPRVVRGSTA
VPARYDAQILGGVFAVWCDLAASQTQDQVAAGIRMPLRAMTQKLWDPRTPTLSWTEFRAL
ARQLG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggccgcaggcggcgcgtccccgaggggaggacgcccgtcaggcgcaacaggttg
ctgctgggtggcgggctgatcgtcgcgggcaccctcggggtgaccgccgtcctctggccc
tccggcggcagcgagccggccggtgcgcgggcgtccaccgcctcctcggccgccgccgcg
acccgtacgccctccccgtcaccgacccgcgcctaccccttgtcgaaggcaccgcgcacg
attcccgccgtacgggagcacacggccgcccgggggccgggctggcgtccggcgaagggc
ggccgggtcgtcgtgggcgacgcggcactggccgacgagggcaagctgaccgcgggcgag
ctggggctggcgtacgcgggccggaccggtgcccgggcgggagacgtggagctggcgctc
gacaagggcaccggtggcccggagtcgtacaccctgaccgtgcggggcggccgggtgcgg
atagccgcccccgccgaggcgggcgtcttctacggcacccgcaccctcaagcaggcggtg
cacggcggcggtacggcgcccgagggcgtcgtacgcgaccggccggccaagccccgacgc
ggcctcatgctcgacatcgcgcgcaagcacttcacggcgggctggatcgaggaccgcata
cgggaactgggcgacctcaagtacaacgagctgggcctgcacttctccgacgaccagggc
ttccgtatcgagtcggcctcgcatccggagatcgtgtcccggcagcacctgaccaaggcg
gaggtccgcgggatcgtcgacctggcggcgagccggcacatcgccgtcgtgcccgagatc
gactcgcccggtcacctgggcgcggtgatcgccgcgcaccccgacctccagctgcgcaac
gcctcgggggtccccgcgcgcggggccgtcgacatctccaagcccgccgccgcgaccatc
gtcgacgacctgctgaacgagtacgccgatctgttccccggcgcgtactggcacctcggc
ggcgacgagtaccaggcgctgatggtgtccgatccgtcggcctcctatccgcagctcgcc
gcggccgcccggaacaagtacggggcgaacgccaccgtcgcggacctcacgaccggctgg
ctcaacggccgcgccgacaacatgcgcgcgcaccaccggacgatgcgggcgtggaacgac
ggcttctaccggtcggccggcacggtccggccggccaaggacatccaggtcgcctactgg
accggcaaggagatcggcgcccggcagccggccgagtacctgagcgcgggccgcaagctc
atcaactacaacgacgagtacctctactacgtgctcggccagccgcagaccttcgtctac
ccgacggggcagcggatctaccagcagtggaccccgcgcgtcgtgcgcggcagcacggcc
gtccccgcgcggtacgacgcccagatcctcggcggggtcttcgcggtgtggtgcgacctc
gcggcctcgcagacccaggaccaggtcgccgccgggatccggatgccgctgcgggcgatg
acccagaagctgtgggatccgcggacgccgacgctgtcctggacggagttccgggcgctg
gcgaggcagttgggctga

DBGET integrated database retrieval system