KEGG   Streptomyces avermitilis: SAV_3396Help
Entry
SAV_3396          CDS       T00126                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sma  Streptomyces avermitilis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_3396 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAV_3396 (sdhD)
   00650 Butanoate metabolism
    SAV_3396 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SAV_3396 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4217790..4218272
Genome map
AA seq 160 aa AA seqDB search
MSTTDTAASGIGPVEGASLYGVDNPAPVIESPRKRTKKTPKSTRGNFEMYGWLFMRLSGI
VLVVLVLGHLLIQLVLDGGVSKIGFAFVAGRWASPWWQVWDLAMLWLAMLHGANGLRTII
NDYAERANTRLWLKGLLYTATVFTILLGTLVIFTFDPNIR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgactgataccgccgcctccgggatcggccccgtagagggcgcctcgctgtac
ggcgtcgacaacccggcgcccgtcatcgagtcgccgcgcaagcggacgaagaagaccccg
aagtccacccgtggcaacttcgagatgtacggctggctgttcatgcgcctgtccggcatc
gtgctggtcgtcctggtcctcggccacctgctgatccagctcgtcctcgacggcggcgtc
tccaagatcggcttcgccttcgtggcaggccgctgggcgtccccgtggtggcaggtctgg
gacctggccatgctgtggctcgcgatgctgcacggcgccaacggcctgcgcacgatcatc
aacgactacgcggagcgggcgaacacgcgcctgtggctgaagggcctgctgtacaccgcc
acggtgttcacgattctgctgggcacgctggtgatcttcaccttcgacccgaacatccgc
tag

DBGET integrated database retrieval system