KEGG   Streptomyces avermitilis: SAV_3567Help
Entry
SAV_3567          CDS       T00126                                 

Gene name
desC
Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sma  Streptomyces avermitilis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sma01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sma01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4418467..4419477
Genome map
AA seq 336 aa AA seqDB search
MTPGSDVIDDVPKANNDSMAASATLGGERKRSLEQITLLLFIIVPFLALLAAVPLAWGWG
VSWLDMGLMVFFYYLGCHGITIGFHRYFTHGSFKAKRPLRIALAIAGSMAVEGPLVRWVA
DHRKHHKFSDAEGDPHSPWRFGETVPALMKGLWWAHIGWMFDEEQTSQEKYAPDLIKDGA
IRAISRQFVLWTGLSLALPPLIGGLVTMSWWGAFTGFFWGSLVRVALLHHVTWSINSICH
AVGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVERGQLDSSARIIRWCER
LGWAYDVRWPSRSRIDSRRHTGEEGSRRKRESADAA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggctccgatgtgatcgacgacgttccgaaggcgaacaacgactccatggcc
gcgtccgcgacgctgggcggcgagcggaaacgttcgctcgagcagatcacgctgctgctc
ttcatcatcgttccgttcctggcgctgctcgcggcggtgccgctggcctgggggtggggg
gtgagctggctcgacatgggcctgatggtgttcttctactacctcggctgccacggcatc
acgatcggcttccaccgctacttcacgcatggttcgttcaaggccaagcggcccttgcgg
atcgcgctggcgatcgccggttcgatggcggtcgagggacctctggtccgctgggtggcc
gaccaccgcaagcatcacaagttctccgacgcggagggtgacccgcattcgccgtggcgt
ttcggcgagacggttccggctctgatgaagggcctgtggtgggcgcacatcggatggatg
ttcgacgaggagcagacgtcgcaggagaagtacgcgccggatctgatcaaggacggtgcg
atccgtgcgatctcgcgtcagttcgtcctgtggacgggtctctcgctggcgctgcccccg
ttgatcggcggtctggtgacgatgtcctggtggggggcgttcaccggcttcttctggggt
tcgctcgtgcgggtggcgctgctgcaccatgtgacgtggtcgatcaactcgatctgtcat
gcggtgggcaagcgtcccttcaagtcgcgtgaccggtcggggaacgtgtggtggctggcg
gtgctgtcctgcggtgagtcgtggcacaacctgcaccacgccgacccgacgtcggcgcgg
cacggggtggagcgcggccagctggattcctcggcgcggatcatccgctggtgcgagcgg
ctgggctgggcttatgacgtgcgctggccgtcacgctcgcgtatcgattcccgccgtcac
accggtgaggaaggctcccggcgcaagagggagagcgccgacgcggcatga

DBGET integrated database retrieval system