KEGG   Streptomyces avermitilis: SAV_3586Help
Entry
SAV_3586          CDS       T00126                                 

Gene name
cmek
Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sma  Streptomyces avermitilis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAV_3586 (cmek)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SAV_3586 (cmek)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4439401..4440294)
Genome map
AA seq 297 aa AA seqDB search
MSVTVRVPAKVNVQLAVGGARPDGFHDLANVFLAVGLYDEVTATPADELRITCEGPDAAQ
VPLDRTNLAARAAIALAARHGLAPDVHLHIAKDIPVAGGMAGGSADAAGALLACDTLWGT
NASRGELLDICAELGSDVPFSLVGGAALGTGRGERLRELEVGGTFHWVFAVADGGLSTPA
VYGEFDRLSEGVRVPEPVASQELLDALAKGDAVALAAAVSNDLQPAALSLFPSLSDTLEA
GRAAGALAALVSGSGPTTAFLTRDADGADAVAQALLASGTCRTARVAPSPAPGATVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgaccgtacgcgtccccgccaaggtcaacgtccagctcgcggtcggcggcgcc
cgccccgacggcttccacgacctggccaacgtcttcctcgccgtcggcctgtacgacgag
gtcaccgcgaccccggccgacgagctgcgcatcacgtgcgaggggcccgacgccgcacag
gtcccgctcgaccgcacgaacctcgccgcccgcgcggcgatcgcgctcgccgcgcgacac
ggcctcgcacccgacgtccacctccacatcgccaaggacatccccgtcgccggcggcatg
gccggcggcagcgcggacgcggccggcgcgctgctcgcctgcgacaccctgtggggtacg
aacgcctcacgcggcgaactcctcgacatctgcgccgagttgggcagcgacgtgcccttc
agcctggtcggcggcgccgcgctcggcaccgggcggggggagcggctgcgggagctggag
gtcggcgggaccttccactgggtgttcgcggtggccgacggcgggctgtcgaccccggcc
gtgtacggggagttcgaccggctgagcgagggcgtacgcgtacccgagcccgtcgcctcc
caggaactgctcgacgcgctggccaagggggacgccgtggccctcgccgccgccgtctcc
aacgacctccagcccgccgcgctgtccctcttcccgtccctcagcgacacgctggaggcg
ggccgtgccgccggcgccctcgccgcgctggtctccggctccgggccgaccacggcgttc
ctcacccgggacgcggacggcgcggacgccgtggcccaggcgctgctcgcgtccggtaca
tgccggacggcgcgggtcgccccgtctcccgcaccgggcgccaccgtcctgtag

DBGET integrated database retrieval system