KEGG   Streptomyces avermitilis: SAV_3956Help
Entry
SAV_3956          CDS       T00126                                 

Definition
dehydrogenase
Orthology
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
sma  Streptomyces avermitilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4880526..4881515
Genome map
AA seq 329 aa AA seqDB search
MHAVRLHAFGPAENLAYEKVEDPEPGPGQVRIAVAAAGVHLLDAALREGVRGPAPEPTPL
PTIPGREVAGTVESLGAGVPGDRLGKRVVAHLGFAPGGYAELAVTDADRLHEIPRNLDFA
QAVAMIGTGRTALGILQFAELGPDSVAVVPAAAGGIGTLLVQYAKSAGATVIGLAGGPQK
VARVRDNGADLAVDYRDPDWPERLAQYRGRATVVFDGVGGDTARTAVGLLGPGGRHLVFG
WSGEGIQNGQPLLVDDKDRGIVSEQVLGPVMLRRAGGPHPLRALELRALAEAAAGRLTPA
VQRFPLAEAAAAHRALESRRTVGKVVLEP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccgtccgcctccacgccttcggcccggccgagaacctcgcgtacgagaaggtc
gaggaccccgagccgggccccggccaggtccgtatcgccgtcgccgccgccggcgtacac
ctcctggacgcggccctgcgcgaaggcgtacggggcccggcccccgagcccaccccgctg
cccacgattcccggccgcgaggtcgccggcaccgtcgagtccctcggcgcgggcgtcccg
ggcgaccggctcggcaagcgcgtcgtcgcccacctcggcttcgcccccggcggctacgcc
gaactcgccgtcaccgatgccgaccgcctccacgagatcccgcggaacctcgacttcgcc
caggccgtcgccatgatcggaacgggccgtacggcgctcgggatcctccagttcgccgag
ctgggcccggactccgtggccgtcgtcccggccgccgccggcggtatcggcacccttctc
gtgcagtacgccaagtccgcgggcgccacggtgatcggcctggccggcggcccgcagaag
gtggcgcgggtacgcgacaacggtgccgacctcgccgtcgactaccgggaccccgactgg
ccggagcggctcgcgcagtaccgcggcagggccaccgtcgtcttcgacggcgtgggcggg
gacacggcccgcacggccgtcgggctcctcggccccggcggcaggcacctcgtcttcgga
tggtccggcgaaggcatccagaacgggcagccgctgctcgtcgacgacaaggaccggggg
atcgtctccgaacaggtcctcggccccgtgatgctgcgccgggcgggcggcccccacccc
ctgcgcgccctggaactgcgcgccctcgccgaggccgcggcgggccggctgaccccggcc
gtccagcgcttcccgctcgccgaggcggcagccgcgcaccgggccctggagagccggcgg
accgtcggaaaagtggtgctcgagccatga

DBGET integrated database retrieval system