KEGG   Streptomyces avermitilis: SAV_3979Help
Entry
SAV_3979          CDS       T00126                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_3979 (gpmA)
   01230 Biosynthesis of amino acids
    SAV_3979 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_3979 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SAV_3979 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAV_3979 (gpmA)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAV_3979 (gpmA)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAV_3979 (gpmA)
  Exosomal proteins of melanoma cells
   SAV_3979 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4905162..4905923
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEAVRGGELLKDAGLLPDVVHTS
LQKRAIRTAQLALESADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPPLADGSEFSQSDDPRYASIPPELRPKTECLKDVVNRMLPYWYDGIVPDLLTGRT
VLVAAHGNSLRALVKHLDGISDEDIAGLNIPTGIPLSYELDTDFKPLNPGGTYLDPDAAA
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgaatggaacgcg
aagaacctgttcaccggctgggtggacgtcaacctcaacgagaagggcgagaaggaggct
gtccgcggcggtgagctgctgaaggacgccggcctgctgcccgacgtggtccacacgtcg
ctccagaagcgcgcgatccgcaccgcccagctcgcgctggagtccgcggaccgccactgg
atcccggtccaccgctcgtggcgcctgaacgagcgtcactacggcgccctccagggcaag
gacaaggcgcagacgctcgccgagttcggcgaggagcagttcatgctctggcgccgctcg
tacgacaccccgcccccgcccctcgcggacggctccgagttctcccagtcggacgacccg
cgctacgcctccatccccccggagctgcgccccaagacggagtgcctcaaggacgtcgtc
aaccggatgctcccgtactggtacgacggcatcgtcccggacctgctgaccggccgcacg
gtcctggtcgcggcccacggcaacagcctccgcgccctggtcaagcacctcgacggcatc
tccgacgaggacatcgcgggcctgaacatcccgacgggcatcccgctgtcctacgaactc
gacacggacttcaagccgctcaacccgggcggcacctacctcgacccggacgcggcggcg
gcggcgatcgaggcggtcaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system