KEGG   Streptomyces avermitilis: SAV_4539Help
Entry
SAV_4539          CDS       T00126                                 

Gene name
cyp20
Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sma  Streptomyces avermitilis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SAV_4539 (cyp20)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SAV_4539 (cyp20)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAV_4539 (cyp20)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SAV_4539 (cyp20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5543376..5544593
Genome map
AA seq 405 aa AA seqDB search
MAAAFDLAFDPWDPAFLADPYPAYADLRAKGRVHYYEPTNQWLVPHHADVSALLRDRRLG
RAYQHRYTHEDFGRTAPPAEHEPFHTLNDHGMLDLEPPDHTRIRRLVSKAFTPRTVEQLK
PYVAKLAGELVDRLVAAGGGDLLADVAEPLPVAVIAEMLGIPESDRAPLRPWSADICGMY
ELNPPKDVAAKAVRASVEFSDYLRELIAERRKEPGDDLISGLIAAHDEGDRLTEQEMIST
CVLLLNAGHEATVNATVNGWYALFRNPDQLAALRADHSLVPAAVEELMRYDTPLQLFERW
VLDEIEIDGTTVPRGAEIAMLFGSANHDPEVFRNPEKLDLTREDNPHISFSAGIHYCIGA
PLARIELAASMTALLEKAPTLGLVAEPKRKPNFVIRGLEGLSVAV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcttttgacctcgccttcgacccctgggacccggcgttcctcgccgacccg
taccccgcctacgccgatctgcgcgccaagggccgcgtgcactactacgagcccacgaac
cagtggctcgtaccgcaccacgcggacgtctcggcgctgctgcgcgaccggcgcctgggg
cgggcgtaccagcaccggtacacgcatgaggacttcggccgcaccgcacccccggcggag
cacgagccgttccacaccctcaacgaccatgggatgctcgacctggagccgccggaccac
acccggatcaggcgcctggtgtcgaaggcgttcacgccgcggaccgtggagcagctcaag
ccgtacgtggccaagctcgccggcgagctggtggaccggctcgtcgcggcgggcggcggg
gatctgctcgcggatgtcgccgagcccctccccgtggccgtcatcgccgagatgctgggc
atcccggagtccgaccgtgccccgctccgtccctggtcggcggacatctgcgggatgtac
gagctgaacccgccgaaggacgtggcggcgaaggcggtgcgggcgtcggtggagttctcc
gactacctgcgcgagctgatcgccgagcgccgcaaggagcccggcgacgatctcatctcg
gggctcatcgccgcccatgacgaaggcgaccgcctcaccgagcaggagatgatctccacc
tgcgtcctgctgctcaacgcgggccacgaggccaccgtcaacgccacggtcaacggctgg
tacgccttgttccgcaaccccgaccagctggccgccctgcgcgccgaccactcgctcgtg
cccgccgccgtggaggagttgatgcgctacgacacgcccctccagctcttcgagcgctgg
gtcctggacgagatcgagatcgacggcacgacggtcccgaggggcgcggagatcgccatg
ctttttggctccgccaaccacgaccccgaggtcttccggaatcccgagaaactcgacctc
acccgcgaggacaacccccacatttccttcagcgcgggcatccactactgcatcggggca
ccgctggcacggatcgagctggcggcttcgatgacggccctcctggagaaggccccgaca
ctgggcctggtggcggagccgaagcggaagccgaacttcgtgatccgggggctggagggg
ctcagcgtcgcggtctga

DBGET integrated database retrieval system