KEGG   Streptomyces avermitilis: SAV_4669Help
Entry
SAV_4669          CDS       T00126                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sma  Streptomyces avermitilis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5694270..5694881)
Genome map
AA seq 203 aa AA seqDB search
MTAFYTEGQSDPTVQPVPASVVERVDAADTTLSNPKRAVISLGSNLGNRLETLQGAIDAL
EDTPGVRVKAVSPVYETEPWGVEPGSQPAYFNAVVLLKTTLPPSSLLERAHAVEEAFHRV
RDEHWGPRTIDVDIVAYADVVSDDPVLTLPHPRAHQRAFVLAPWYDVDPEAQLPGRGPVE
QLLAAVTRDGIVPRADLELRLPE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgttctacaccgagggtcagagcgacccgaccgttcagccggtgcccgcctcc
gtggtggagcgggtggacgccgccgacacgaccctctccaaccccaagcgcgcggtgatc
tccctgggctcgaacctgggcaaccgcctggagacgctccagggcgcgatcgacgccctg
gaggacacgcccggcgtccgcgtcaaggcggtctctcctgtctacgagacggagccgtgg
ggcgtggagcccggcagccagcccgcgtacttcaacgcggtggtgctcctgaagacgacc
ctgcccccgtcgtccctcctggagcgggcccacgccgtcgaggaggcgttccaccgcgtc
cgggacgagcactggggcccgcgcacgatcgacgtggacatcgtcgcgtacgccgacgtg
gtctccgacgatccggtgctcacgcttccccacccccgcgcccaccagcgggcgttcgtc
ctggccccctggtacgacgtggacccggaggcccagctccccggccgcggccccgtggag
cagctgctggcggccgtcacgcgcgacggcatcgtgccgcgcgccgacctggaactccgg
ctgcccgagtag

DBGET integrated database retrieval system