KEGG   Streptomyces avermitilis: SAV_4672Help
Entry
SAV_4672          CDS       T00126                                 

Gene name
folP2
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sma  Streptomyces avermitilis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5696014..5696946)
Genome map
AA seq 310 aa AA seqDB search
MSKKSGRGRVAGLPTWDRCAVMGVVNVTPDSFSDGGRWFDTTTAVKHGLDLVTEGADLVD
VGGESTRPGATRVDEAEELKRVIPVVRGLASEGVTISVDTMRASVAEQALAAGAALVNDV
SGGLADPEMIPVVAAAGAPFVVMHWRGFLAGGTIRGTYDDIVSEVVDELHARVEAVLEGG
IAPDRIVVDPGLGFSKEADHDLTLLAHLDRLRDLGHPLLVAASRKRFLGRVLAGPEGAPP
PARERDAATAAVSALAAHQGAWAVRVHEVRATADAVRVARAVEGARSERSAQAAPAAAAP
DTAQAAEGAR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagagcgggcgcggccgagtggcgggactgcctacatgggaccgctgcgcg
gtcatgggggtcgtcaacgtgacgcctgattccttctccgacggcggccgctggttcgac
accacgaccgccgtcaagcacggactcgacctggtcaccgagggcgcggacctcgtcgac
gtcggcggcgagtccacccgccccggcgccacccgcgtcgacgaggccgaggaactcaag
cgcgtcatcccggtcgtccgcggtctcgcctccgaaggcgtcacgatctccgtggacacc
atgcgcgcctccgtcgccgagcaggccctcgcggccggcgcggccctcgtcaacgacgtc
agcggcggcctcgccgacccggagatgatcccggtcgtcgcggccgcgggcgcccccttc
gtggtgatgcactggcgcggcttcctggccggcggcaccatacgagggacgtacgacgac
atcgtctccgaagtggtcgacgaactgcacgcacgcgtggaggccgttctggaaggcggc
atcgcgcccgaccggatcgtcgtcgacccgggcctcggcttctccaaggaggccgaccac
gacctgacgctgctggcccacctcgaccggctgcgcgacctgggccacccgctgctggtc
gccgcgtcccggaagcggttcctgggccgcgtactggcaggccccgagggcgccccgccg
cccgcccgggagcgcgacgcggccaccgccgcggtctccgcgctcgccgcccaccagggc
gcgtgggcggtccgcgtgcacgaggtacgggccacggcggacgccgtacgcgtcgcccgc
gccgtggaaggcgcccgctccgagcgcagcgcgcaggcagcccccgcggcggccgccccg
gacaccgcccaggccgcagagggagcccggtga

DBGET integrated database retrieval system