KEGG   Streptomyces avermitilis: SAV_4741Help
Entry
SAV_4741          CDS       T00126                                 

Gene name
hemD
Definition
uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sma  Streptomyces avermitilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sma00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5780485..5782200
Genome map
AA seq 571 aa AA seqDB search
MSPTTLPAGPEHGHVTFLGAGPGDPGLLTLRAVEALARADVLVAEHEVLDVVRTHARQGV
AVLNTSSDAYSDTSSGTYSATSTPQLAVVDSTSTTAGTPASRDAANLVMEAARGGRRVVR
AVSGDPGLDTYAAEEMLACAAAGVPFEVVPGIAAAVGVPAYAGVPLRDAQGADVRFVDAR
SASERCWTEVGASDGTVVVSATLDSVAAAAGELVAAGRKPDTPMSVTIAGTTTRQRTWSA
TLGSIAQTLKQAKVLPSPDGGRPVIAVVGERSAAAQRDQLSWFESKPLFGWKVLVPRTKE
QAASLSDQLRSYGAVPHEVPTIAVEPPRTPQQMERAVKGLVTGRYEWIAFTSVNAVKAVR
EKFEEYGLDARAFAGIKVAAVGEQTAKALVAFGVKPDLVPSGEQSAAGLLEDWPPYDPVF
DPIDRVFLPRADIATETLVAGLIELGWEVDDVTAYRTVRASPPPAETREAIKGGGFDAVL
FTSSSTVRNLVGIAGKPHNVTVIACIGPATAKTAEEHGLRVDVMAPEPSVLKLAEALADF
GLRRRASALDAGDPVTRPSERRPGSRRRRTT
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
ttgagccccaccacccttcccgccggtccggaacacgggcacgtcaccttcctgggtgcc
ggtcccggagatccgggactgctcacactgcgcgccgtggaggcgctggcgagagcggac
gttcttgtcgccgagcatgaggtgctcgacgtggtccgtacgcatgccaggcaaggcgtc
gccgtgctgaacacgtcttcggatgcgtattcggatacgtcgtcaggtacgtattcggcc
acaagcacgcctcaactagcggttgttgacagcacgtcgacgaccgctgggacccccgcg
tcgagggatgccgccaatcttgtcatggaggccgcgcggggcggcaggcgggtcgtgcgt
gcggtgtccggtgaccccggcctcgacacgtacgcggccgaggagatgctggcgtgcgcc
gccgcgggcgtgccgttcgaggtggtgcccggcatcgcggccgccgtgggtgtgcccgct
tacgcgggtgtgccgctgcgggacgcgcagggcgccgacgtgcggttcgtggacgcccgt
tcggcgtcggagcggtgctggaccgaggtgggcgcgtccgatgggaccgtcgtcgtctcg
gccacgctggattccgtggccgcggccgcgggcgagctggtcgccgccggccgtaagccc
gacactccgatgtcggtgaccatcgccggtaccaccacacggcagcgcacctggtccgcc
acgctcgggtccatcgcgcagacgctgaagcaggcgaaggtgctgccctcgcccgacggc
ggccgaccggtgatagccgtggtcggtgagcgttccgccgccgcccagcgcgaccagctg
tcgtggttcgagtccaagccgctgttcggctggaaggtgctcgtgccgcggacgaaggag
caggcggcgtcgctctccgaccagctgcggtcgtacggggccgtgccgcacgaggtgccg
acgatcgccgtcgaaccgccgcggacgccccagcagatggagcgcgcggtcaagggcctg
gtgacgggccggtacgagtggatcgccttcacctcggtgaacgcggtcaaggccgtgcgg
gagaagttcgaggagtacgggctcgatgcccgggccttcgccgggatcaaggtcgcggcg
gtgggcgagcagaccgcgaaggcgctggtcgccttcggtgtgaagccggacctggtgccg
agcggtgagcagtcggccgccggtctgctggaggactggccgccgtacgacccggtcttc
gacccgatcgaccgggtgttcctgccgcgggcggacatcgcgaccgagacgctggtcgcc
gggctcatcgagctgggctgggaggtcgacgacgtcacggcgtaccggacggtgcgcgcg
tcgccgccgccggccgagacgcgggaggccatcaagggcggtggcttcgacgccgtgctg
ttcacgtcgtcctcgacggtgcgcaacctggtcggcatcgcgggcaagccgcacaacgtg
acggtgatcgcgtgcatcggtcccgccacggccaagacggccgaggagcacgggctgcgg
gtggacgtcatggctcccgagccctcggtgctcaagctggcggaggcgctggcggacttc
gggctgcggcgccgtgcgtcggcgctggacgccggggatccggtgacgcggccgagcgag
cggcggccggggtcgcggcggcggcgtacgacgtag

DBGET integrated database retrieval system