KEGG   Streptomyces avermitilis: SAV_5017Help
Entry
SAV_5017          CDS       T00126                                 

Gene name
choD
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sma  Streptomyces avermitilis
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:sma00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6073813..6075618
Genome map
AA seq 601 aa AA seqDB search
MPQENSAQPPVGYPYDYDVIVVGSGFGGSVTALRLTEKGYRVGVLEAGRRFTRESLPKNS
WDIKNYLWAPRLGMYGIQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKAFFDDPQWKD
ITDWQEELKPYYDQARRMLGVRLNPTMTPSDVHLKAAAGRMGVGDTFHMAPVGVFFGDGQ
DADGTAKAKPGGEVEDPYFGGAGPARKACTECGECMTGCRHGAKNTLNENYLHLAERAGA
VVHPMTTVVAVTDDSQGGYAVQTLPTDEKRKGRGRTFKARRVVVAAGTYGTQTLLHRMKE
GRQLPYLSGRLGELTRTNSEALVGAQTDSRRYRKAHGEPTVDFTRGVAITSSIHPDANTH
IEPVRYGRGSNAMGGLSILQVPYAEGSSRLLAWLANAAKHPLLVARSLSNRRWSERTIIG
LVMQSLDNSLTTYLKPKGAGKGLLTARQGHGAPNPKQIRAASQAATVIAEEINGFPGSNV
GELMGTPLTAHFLGGCPIGDSPASGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTIT
AQAERAMSYWPNKGEADPRPAQGAAYERLKPVEPRHPAVPADAFGALRLPFLGMPTVPPK
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgccacaggagaactctgcccaaccgccggtgggctacccgtacgactacgacgtcatc
gtcgtcggttccggcttcggcgggtcggtcacggccctcaggctcaccgagaagggctac
cgcgtaggcgtgctggaggcgggccgccgcttcacgcgcgagtcgctgcccaagaactcc
tgggacatcaagaactatctgtgggcgcccaggctcggcatgtacggcatccagcgcatc
cacctcctgggcaacgtcatggtgctggcgggcgccggggtcggcggcggctccctcaac
tacgcgaacaccctctacgtaccgccgaaggccttcttcgacgacccgcagtggaaggac
atcaccgactggcaggaggaactgaagccgtactacgaccaggcgcggcgcatgctgggc
gtgcggctcaacccgaccatgacgccgtcggacgtccacctcaaggcggccgccgggcgg
atgggcgtcggtgacaccttccacatggcgccggtcggtgtcttcttcggcgacgggcag
gacgcggacgggacggcgaaggccaagccgggcggcgaagtggaagacccctacttcggc
ggcgcggggcccgcccgcaaggcgtgcaccgagtgcggggagtgcatgacgggctgtcgc
cacggggcgaagaacaccctcaacgagaactatctccacctcgccgagcgggccggcgcc
gtcgtgcacccgatgacgaccgtcgtcgcggtcaccgacgactcgcagggcgggtacgcg
gtccagaccctgcccaccgacgagaagcgcaagggccggggcaggaccttcaaggcgcgg
cgggtggtcgtcgccgccggtacgtacggcacgcagaccctgctgcaccggatgaaggag
ggccgtcaactgccctacctgtccggcaggctgggcgagctgacccgtaccaactccgag
gcgctggtcggcgcgcagaccgactcccgccgctaccgcaaggcgcacggcgagcccacg
gtcgacttcacgcgcggggtcgccatcacgtcctccatccaccccgacgcgaacacccac
atcgagccggtccgctacggccggggctcgaacgcgatgggcggcctgtccatcctccag
gtcccctacgcggagggctcctcgcggctgctcgcctggctggccaacgcggcgaaacac
ccgctgctggtggcccgctcgctctccaaccgccgctggtccgagcggaccatcatcggc
ctggtgatgcagtcgctggacaactccctgacgacgtatctgaaaccgaagggcgcgggc
aagggcctgctgacggcacgccaggggcacggcgcgcccaaccccaagcagatcagggcg
gcttcgcaggccgcgaccgtgatcgccgaggagatcaacggattcccgggcagcaacgtg
ggcgagctgatgggaacaccgctgaccgcgcacttcctgggtggctgcccgatcggcgac
tcgccggcgtcgggggtcatcgacccgtaccaccggctgtacggccaccccggtatctcg
gtcgtcgacggcgccgcggtctccgcgaacctcggcgtgaacccgtcgctcaccatcacg
gcccaggccgagcgggcgatgtcgtactggcccaacaagggcgaggcggacccgcgtccg
gcgcagggagcggcgtacgaacgcctgaagccggtggagccgcggcacccggcggtcccg
gcggacgcgttcggcgcgctcaggctgccgttcctggggatgccgacggtgccgccgaag
gagtag

DBGET integrated database retrieval system