KEGG   Streptomyces avermitilis: SAV_5120Help
Entry
SAV_5120          CDS       T00126                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sma  Streptomyces avermitilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAV_5120
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SAV_5120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6218210..6219370
Genome map
AA seq 386 aa AA seqDB search
MYDEQQLPAQQDHGPLAGFTVGVTAARRADELGALLQRRGASVVHAPALRIVPLADDSEL
LAATKGLIEQAPDVVVATTAIGFRGWIEAADGWGLGEDLIERLRGVELLARGPKVKGAVR
AAGLTEEWSPSSESMAEVLDRLLEEGVDGRRVAIQLHGEPLPGFVEALRAGGAEVVGVPV
YRWMPPEDITPVDRLLDATVTRGLDAITFTSAPAAASLLSRAEERGLLSDVLAALHHDVL
PACVGPVTALPLQARGVDTVQPERFRLGPLVQLLCKELPGRARTLPIAGHRVEIRGHAVM
VDGALRPVPPAGMSLLRALARRPGWVVARAELLRALPGAGRDEHAVETAMARLRTALGAP
KLIQTVVKRGYRLALDPAADAKYADA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgaacagcagctaccggctcaacaagatcacggaccgctcgccgggttcacc
gtgggcgtgacggccgcacgtcgggccgacgagctcggcgcgctgctccagcggcgcggt
gcctccgtcgtgcacgcccccgccctgcggatcgtgccgctcgccgacgacagcgaactg
ctcgccgccaccaagggactcatcgaacaggccccggacgtcgtggtggcgacgaccgcg
atcgggttccgggggtggatcgaggccgccgacgggtggggtctcggcgaggatctgatc
gagcggctgcggggggtcgaactgctggcccgcgggcccaaggtcaagggcgccgtacgc
gccgcggggctgacggaggagtggtcgccctcctccgagtccatggccgaggtgctcgac
cggctgctcgaagaaggcgtcgacggtcgccgtgtcgccatccagctgcacggcgagccg
ctgcccggcttcgtggaggcgctgcgggccgggggagcggaggtcgtcggcgtacccgtg
taccggtggatgccgccggaggacatcacgcccgtcgaccggctgctcgacgcgaccgtc
acccgaggcctcgacgcgatcaccttcaccagcgcgcccgccgccgcgtccctgctgtcc
cgggcggaggagcgggggctgctgtccgacgtcctcgccgccctccaccacgacgtgctg
cccgcctgtgtcggcccggtcaccgcgctgccgctccaggcccggggcgtcgacaccgtc
cagcccgaacgcttccggctcggccccctcgtacaactgctgtgcaaggagctgcccggg
cgggcccgtacactccccatcgccggccaccgcgtcgagatccgcggccacgcggtcatg
gtcgacggagcgctgcggcccgtaccgcccgccgggatgtccctgctgcgggccctggcg
cgccggccgggctgggtggtggcgcgggccgagctgctgcgggcgctgccgggggccggc
cgggacgagcacgccgtcgagacggcgatggcccggctgcgcacggcactcggcgcgccc
aagctgatccagacggtggtcaaacgcggctaccggctcgccctcgacccggcggcggac
gccaagtacgccgacgcgtga

DBGET integrated database retrieval system