KEGG   Streptomyces avermitilis: SAV_5128Help
Entry
SAV_5128          CDS       T00126                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sma00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sma00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6227970..6229316)
Genome map
AA seq 448 aa AA seqDB search
MTVNGSDDVLLVHGGTPLEGEIRVRGAKNLVPKAMVAALLGSEPSRLRNVPDIRDVRVVR
GLLQLHGVTVRPGEEPGELVLDPSHVESANVADIDAHAGSSRIPILFCGPLLHRLGHAFI
PGLGGCDIGGRPIDFHFEVLRQFGAKIEKRADGQYLEAPQRLRGTKIQLPYPSVGATEQV
LLTAVLAEGVTELANAAVEPEIEDLICVLQKMGAIIAMDTDRTIRITGVDSLGGYTHAAL
PDRLEAASWASAALATEGNIYIRGAQQRSMMTFLNTYRKVGGAFEIDDEGIRFWHPGGQL
KSIALETDVHPGFQTDWQQPLVVALTQATGLSIIHETVYESRLGFTSALNQMGAHIQLYR
ECLGGSDCRFGQRNFLHSAVVSGPTKLQGADLVIPDLRGGFSYLIAALAAQGTSRVHGID
LINRGYENFMEKLVELGAKVELPGKALA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaacggctcagacgatgtactgcttgtccacggcggaaccccgctcgagggc
gagatccgggtccgcggtgcgaagaacctcgtgccgaaggccatggtcgccgccctgctg
ggcagcgagccgagccggctgcgcaacgtccccgacatccgcgacgtgcgcgtcgtgcgc
ggactgcttcagctgcacggggtgacggtccgcccgggagaggagccgggcgaactggtc
ctggacccgtcgcacgtcgagagcgcgaacgtcgcggacatcgacgcgcacgcgggttcg
tcccgtatcccgatcctcttctgcggcccgctgctgcaccgcctcgggcacgcgttcatt
ccgggcctgggcggctgtgacatcggcggccggccgatcgacttccacttcgaggtgctg
cggcagttcggcgcgaagatcgagaagcgggcggacggccagtacctggaggctccgcag
cggctgcgtggcaccaagatccagctgccgtacccctccgtgggcgccaccgagcaggtg
ctgctgacggccgtcctcgcggagggcgtcaccgagctggccaacgcggcggtcgagccg
gagatcgaggacctgatctgcgttctgcagaaaatgggcgcgatcatcgcgatggacacc
gaccgcaccatccggatcacgggtgtcgactcgctcggcggctacacccacgcggccctc
ccggaccgcctggaggccgcctcctgggcgtccgcggcgctggcgaccgaaggcaacatc
tacatccgcggcgcccagcagcgctcgatgatgacgttcctgaacacctaccgcaaggtc
ggcggcgccttcgagatcgacgacgagggcatccgcttctggcaccccggcggccagctg
aagtcgatcgcgctggagacggacgtgcaccccggcttccagacggactggcagcagccc
ctggtcgtggccctcacccaggccacgggcctgtcgatcatccacgagacggtgtacgag
tcccggctcggcttcacctccgcgctcaaccagatgggcgcgcacatccagctctaccgc
gagtgcctcggcggctccgactgccgcttcggccagcgcaacttcctgcactcggcggtc
gtctccggccccaccaagctccagggcgccgacctggtcatccccgacctccgcggcggc
ttctcgtacctgatcgcggccctcgcggcccagggaacctcgcgggtgcacggcatcgac
ctgatcaaccgcggctacgagaacttcatggagaagctcgtggaactcggcgcgaaggtc
gaactgcccggcaaggcactcgcctga

DBGET integrated database retrieval system