KEGG   Streptomyces avermitilis: SAV_5134Help
Entry
SAV_5134          CDS       T00126                                 

Gene name
nagZ3
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sma  Streptomyces avermitilis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAV_5134 (nagZ3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAV_5134 (nagZ3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SAV_5134 (nagZ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6233930..6235663
Genome map
AA seq 577 aa AA seqDB search
MTDVTDVMALIPAPRHVGACGEGFFELGPDTRLAAGAGTERTARWLRGTIGAATGFPLAP
GDGGIRLSVHPTVTRDLGEEGYRLAVTPDAVHLVGGGPAGLFWGAQTLRQLLGPGAHRRA
PLPGGQWRLPLTHIQDSPRFPWRGVMLDVSRHFMPKDGVLRHLDLMAAHKLNVFHFHLTD
DQGWRIEIKRYPKLTEVGSWRARTKFGHRASQRWEEKPHGGFYTQDDIREIVAYAAERHI
TVVPEIDIPGHSQAAIAAYPELGNSDVIDTTSLTVWDDWGVSKNVLAPTDNTLRFYEGVF
EELLELFPADAAAFSAFVHIGGDECAKDQWKQSPAVQARIEELGLTGEDALQAWFVRHFG
TWLAARGRRLIGWDEILEGGSRAAGTRAEATRAAGTRAPGGETADIGLPEGAAVSSWRGY
QGGITAARAGHDVVMCPEQQVYLDHRQDGGADEPVPIGYVRTLEDVYRFEPVPPQLTEDE
ARHVLGTQANLWTEVMEDHARVDYQAFPRLAAFAEVAWSALPAPAERDFADFERRMTAHY
GRLDALGVAYRPPTGPLPWQRRPGVLGRPIEGPPPNA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgtgaccgacgtgatggcactgattcccgcgccccggcacgtgggggcgtgc
ggcgaaggcttcttcgagttgggcccggacacccggctggcggcgggtgccgggaccgaa
cggaccgcgcgatggctgcgcggcacgatcggggcggccaccggcttcccgctcgcaccg
ggcgacggcgggatcaggctgtccgtccacccgacggtgaccagggacctcggcgaggag
ggctaccggctcgcggtcacgccggacgcggtgcacctggtcggcggcggccccgccggg
ctcttctggggcgcccagaccctgcggcagctgctcggtcccggcgcccaccggcgggcg
ccgctgcccggcgggcagtggcggctgccgctgacgcacattcaggattcgccccggttc
ccctggcgcggcgtcatgctcgacgtctcccggcacttcatgcccaaggacggcgtcctg
cgccacctggatctgatggccgcccacaaactcaacgtcttccacttccacctcaccgac
gaccagggctggcgcatcgagatcaagcggtacccgaagctcacggaggtcggatcctgg
cgggcgcgcaccaaattcggccaccgcgcttcacaacggtgggaggagaagccgcacggc
ggcttctacacgcaggacgacatccgcgagatcgtcgcctacgcggccgagcggcacatc
accgtcgtccccgagatcgatatcccgggccactcgcaggccgccatcgccgcgtatccg
gaactcggcaactccgacgtcatcgacacgacctccctgacggtctgggacgactggggc
gtctccaaaaacgtactcgcccccactgacaacaccctgcgcttctacgagggcgtgttc
gaggaactcctggagctgttcccggccgacgccgccgcgttctcggccttcgtccacatc
ggcggcgacgagtgcgccaaggaccagtggaagcagtcgcccgccgtccaggcccgcatc
gaggagctggggctcacgggcgaggacgcgctccaggcgtggttcgtccggcacttcggc
acctggctcgccgcgcgcgggcgccggctcatcggctgggacgagatcctggagggcggg
agccgcgccgcagggacacgtgccgaagcgacacgcgccgcagggacacgcgcgcccgga
ggtgagacggcggacatcggcctcccggaaggggccgccgtctcctcgtggcgcggctac
cagggcggcatcacggccgcccgcgcgggccacgacgtcgtcatgtgccccgaacagcag
gtctacttggaccaccgccaggacggcggcgcggacgagccggtgcccatcgggtacgtg
cgcaccctggaggacgtctaccgcttcgagcccgttccgccgcagctcaccgaggacgag
gcgcgccatgtgctgggcacccaggccaatctgtggaccgaggtgatggaggaccacgca
cgcgtggactaccaggcgttcccgcggctcgcggccttcgccgaggtcgcctggagcgcg
ctgcccgcccccgccgaacgggacttcgccgacttcgagcggcggatgaccgcccactac
ggacggctcgacgccctgggagtggcctaccgcccgcccacgggaccgctgccctggcag
cggcggccgggtgtgctcggacgcccgatcgaggggccgcccccgaacgcgtag

DBGET integrated database retrieval system