KEGG   Streptomyces avermitilis: SAV_5217Help
Entry
SAV_5217          CDS       T00126                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAV_5217
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SAV_5217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6323049..6324065
Genome map
AA seq 338 aa AA seqDB search
MYGKRGAGALAAVALAGAALLLAGCSAPEDNSKKGGGGADIAQRPKGSDPFWVNPEGNAA
EQLATYARAGRKDDAEQIRKIAEQPTGEWIGPENPEAEARGYTEAAEKADRTALLVLYNI
PHRDCGQFSQGGAADGDAYRAWIDGVTKGIGDRNTTVVLEPDALLHIVDGCTPDEFHEER
YDLLKGAIAKLGALKNTKVYLDAGNAGWGHPDQIFQPLQRAGVDRADGFAVNVSNFYTTR
DSIAYGKQLSAKVGDKHFVIDTSRNGNGPYTAGKADENWCNPPGRALGETPSTKTADPLV
DAYVWVKRPGESDGTCKGGPKAGEWWSDYALKLARASK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggaagaggggggccggggcactggcggccgtggcgttggcgggggccgcgctg
ctgctggcggggtgttccgctcccgaggacaacagcaagaagggcggcgggggcgctgac
atcgcgcagcggccgaaaggctcggacccgttctgggtcaaccccgaggggaacgcggcc
gagcagctcgccacctacgcgagagcgggcaggaaggacgacgccgagcaaatccggaag
atagcggagcagccgacgggggagtggatcgggccggagaacccggaagcggaggcgcgc
ggttacacggaggccgcggagaaggcggaccgcaccgcgctcctcgtcctctacaacatt
ccgcaccgcgactgcgggcagttctcgcagggcggcgccgcggacggcgacgcgtaccgg
gcctggatcgacggcgtgaccaagggcatcggggaccggaacacgacggtggtcctggag
ccggacgcgctgctgcacatcgtcgacggctgcacgccggacgagttccacgaggagcgc
tacgacctgctcaagggcgcgatcgccaagctcggagcgctgaagaacaccaaggtctac
ctggacgcgggcaacgcgggctggggccaccccgaccagatcttccagccgctccagcgg
gcgggcgtcgaccgggccgacggcttcgcggtcaacgtctccaacttctacacgacgcgg
gactccatcgcgtacggcaagcagctgtcggcgaaggtcggcgacaagcacttcgtgatc
gacacgagccgcaacggcaacgggccgtacacggcgggcaaggcggacgagaactggtgc
aacccgccggggcgggcgctgggcgagaccccgtccacgaagacggccgatccgctggtg
gacgcgtatgtgtgggtcaaacgcccgggcgagtcggacggcacgtgcaagggcggcccg
aaggcgggcgagtggtggtccgactatgcgctgaagctggcccgcgcgtccaagtag

DBGET integrated database retrieval system