KEGG   Streptomyces avermitilis: SAV_5285Help
Entry
SAV_5285          CDS       T00126                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sma  Streptomyces avermitilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sma00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6403444..6404412
Genome map
AA seq 322 aa AA seqDB search
MSSNETPRGPVDSSRVPRYAGPATFARLPRLDEVGTADVAVVGVPFDSGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETVEAAADELLGTGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGIL
DTEALSHVGTRGPLYGKQDLTDDEKMGFGIVTSADIYRRGADEVADQLRQRIGDRPLYIS
IDIDCLDPAHAPGTGTPEAGGMTSRELLEILRGLASCNLVSADVVEVAPAYDHAEITAVA
ASHTAYELTTIMSRQIAEARNK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacgagacgccccgcggccccgtcgactcgtcccgcgtcccgcggtacgcc
ggccccgcgaccttcgcccggctgccgcgcctcgacgaggtcggcaccgccgatgtcgcc
gtggtcggtgtgccgttcgactccggcgtctcgtaccggccgggcgcccgcttcggcggc
aacgcgatccgcgaggcgtcccggctcctgcgcccgtacaacccggcgcaggacgcctcg
cccttcgcgctcgcccaggtcgcggacgcgggtgacatcgcggcgaacccgttcaacatc
aacgaggccgtggagacggtcgaggccgcggccgacgagctgctcggcaccggcgcccgg
ctgatgaccctcggcggcgaccacaccatcgcgctgccgctgctgcgctcggtcgccaag
aagcacggcccggtggcgctgctccacttcgacgcgcacctcgacacctgggacacctac
ttcggcgccgagtacacgcacggcaccccgttccgccgggccgtcgaggagggcatcctc
gacaccgaggcgctctcccacgtcggcacccgcggcccgctgtacggcaagcaggacctc
accgacgacgagaagatgggcttcggcatcgtcacctcggcggacatctaccgccgcggc
gccgacgaggtcgccgaccagctgcgccagcgcatcggtgaccgtccgctgtacatctcc
atcgacatcgactgcctcgacccggcgcacgcgcccggcacggggacgccggaggcgggc
ggcatgacgtcgcgcgaactcctggagatcctgcggggcctcgcgtcctgcaacctggtc
tcggccgacgtcgtcgaggtcgccccggcgtacgaccacgccgagatcacggccgtcgcc
gcgtcccacacggcgtacgagctcaccacgatcatgtcccgtcagattgcggaggcccgg
aacaagtga

DBGET integrated database retrieval system