KEGG   Streptomyces avermitilis: SAV_5302Help
Entry
SAV_5302          CDS       T00126                                 

Gene name
nagZ5
Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sma  Streptomyces avermitilis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAV_5302 (nagZ5)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SAV_5302 (nagZ5)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SAV_5302 (nagZ5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6426573..6428423)
Genome map
AA seq 616 aa AA seqDB search
MRDSGTGSTGNTGNTGNTAQPSRRTVLAATAGAGAVLAVSGTAHAGPSGDRKLRALISRM
TLEEKVGQLFVMRVYGHSATAPDQADIDANLKELGVRTAAELIATYRVGGIIYFTWAHNT
RTPHQIADLSNGIQKASLDQPRGLPVLIATDQEHGIVARVGKPATLFPGAMAIGAGGSRS
DARTLGRIGGAELRALGILQDYSPDADVNVNPANPVIGVRSFGADPDAVAGLVAAEVKGY
QQSGVAATAKHFPGHGDTAVDSHFGFPVITHSRELWGELDAVPFRAAVRAGIDSIMTAHI
MVPALDASGDPATLSRPILTGILREELGYDGVVVTDSLGMEGVRQKYGDDRVPVLALKAG
VDQLLNPPSIDIAWHAVLNAVRGGELTEARLDESILRVLRLKSKLGLLHDPYVTERGVDR
TVGTPEHLRAADRIADRTTTLLINKQGLLPLSRRTRPRVLVVGADPASPSGTDGPPTTVL
AAALTELGFTATALSTGTAPSTATIAKAVAAAGSADAVVVGTYNVTAGSSQRTLVNKLVA
TGVPVVAVAIRNPYDVAQLPDVGACLASYSWTDVELRAAARVIGGRVTPRGKLPVAVQRA
DAPEQVLYPIGYGLTY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactccggcacgggaagcacgggaaacacgggaaacacgggaaacaccgcacag
ccgtccagacgtaccgtcctcgccgccaccgcgggtgccggcgccgttctcgccgtcagc
gggaccgcacacgccggcccgagcggcgaccggaaactccgcgccctcatctcccgtatg
acgctggaggagaaggtcgggcagctcttcgtgatgcgggtgtacggccattcggccacc
gcgcccgaccaggccgacatcgacgccaacctcaaggagctcggcgtacggacggccgcc
gagctgatcgccacgtaccgcgtcggcggcatcatctacttcacctgggcgcacaacacc
cgcaccccgcaccagatcgccgacctgtccaacggcatccagaaggcctccctcgaccag
ccgcgcggactgcccgtcctgatcgccaccgaccaggagcacgggatagtcgcgcgcgtg
ggaaagcccgccaccctcttccccggcgcgatggccatcggcgccgggggctcccgctcg
gacgcccgcacgctcggccggatcggcggcgccgagctgcgcgcgctcggcatcctccag
gactactcccccgacgccgacgtgaacgtcaacccggccaacccggtcatcggcgtacgg
tccttcggcgccgatccggacgcggtggccggtctggtcgcggcggaggtgaaggggtat
cagcagtccggcgtcgcggcgaccgccaagcacttcccggggcacggcgacaccgccgtc
gacagccacttcggcttcccggtcatcacacacagccgcgaactgtggggggagctcgac
gcggtccccttccgggcggccgtccgggccggcatcgactccatcatgaccgcgcacatc
atggtcccggccctggacgcctccggcgatccggcgacgctctcccgccccatcctcacc
ggcatcctgcgcgaggaactgggctacgacggggtcgtggtgacggactccctcggcatg
gagggcgtacgccagaagtacggcgacgaccgcgtgcccgtgctggccctgaaggccggt
gtcgaccagctcctcaacccgccgtcgatcgacatcgcgtggcacgcggtgctgaacgcg
gtgcgcggcggcgagctgaccgaggcccgcctcgacgagtcgatcctgcgcgtcctgcgg
ctgaagtcgaagctcgggctgctgcacgacccctatgtcaccgagcgcggcgtcgaccgg
acggtgggcaccccggaacacctgcgcgcggcggaccgcatcgcggaccgtacgaccacg
ctgctgatcaacaagcagggcctgctcccgctgtcccgccgtacccgcccgagggtcctc
gtcgtgggcgccgaccccgcgtcaccgtccggcaccgacggaccaccgaccaccgtgctc
gccgccgccctcaccgagctgggcttcacggcgacggccctgtccaccggcacggcaccg
tcgacggcgacgatcgccaaggcggtggcggcggccgggagcgccgacgcggtggtggtg
ggcacgtacaacgtgacggcgggcagttctcagcgcaccctggtgaacaagctggtcgcc
acgggcgtcccggtggtcgcggtcgccatccgcaacccgtacgacgtggcccagctcccc
gacgtcggcgcctgcctggcctcgtactcctggaccgacgtcgaactgcgcgcggcggcc
cgggtgatcggcgggcgggtgacaccgcgggggaagcttccggtggcggtgcagcgcgcg
gacgcgccggagcaggtgctgtatccgatcgggtacgggctgacgtactag

DBGET integrated database retrieval system