KEGG   Streptomyces avermitilis: SAV_5317Help
Entry
SAV_5317          CDS       T00126                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sma  Streptomyces avermitilis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAV_5317 (rbsK)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SAV_5317 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6443538..6444437)
Genome map
AA seq 299 aa AA seqDB search
MYDYDLLVVGSANADLVIGVERRPAAGETVLGSDLVVHPGGKGANQAVAAARLGARTALL
ARVGDDAHGRLLLDSQRRAGVDTVGVLVGGAPTGVALITVDPSGDNSIVVSPGANGRLAP
RDVRAADSLLRSAAVVSAQLEIPLESVVEVVRNLAPGTRFVLNPSPPRPLPEEVLAACDP
LIVNEHEARVIAGGELDGSPEDWAAALLALGPRSVVVTLGAEGALVASAEGTARVPSVRV
DAVDTTGAGDAFTAALAWRLGLGESLVRAAAYAARVGASAVTRSGAQASFPTAEEVAAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactacgaccttctggtcgtgggatcggccaacgccgacctggtgatcggggtc
gagcggcggcccgcggcgggagagaccgtgctcggctccgatctggtcgtccacccgggc
ggcaagggcgcgaaccaggcggtcgccgccgcccgcctcggggcccgtacggccctgctg
gcgcgggtcggcgacgacgcgcacggccggctgctgctcgactcgcagcggcgggcgggc
gtcgacaccgtgggcgtgctggtcggcggggcgcccaccggggtcgcgctgatcacggtg
gacccgtccggggacaacagcatcgtggtctcgccgggggcgaacggccggctggcgccg
cgggacgtacgggccgcggacagcctcctccggtccgccgccgtggtctcggcgcagctg
gagatcccgctggagtcggtcgtggaggtcgtacggaatctggcgcccggcacccgtttc
gtactgaacccgtcgccgccccggccgctgcccgaggaggtgctggcggcctgcgatccg
ctgatcgtgaacgagcacgaggcgcgggtcatcgcgggcggtgagctggacggttccccc
gaggactgggcggcggcgctgctggcgctggggccgcgttcggtggtggtgacgctgggc
gccgagggtgcgctggtggcttccgccgagggcaccgcccgggtgccgtccgtgcgggtg
gacgcggtggacacgacgggtgcgggcgacgcgttcacggcggcgctggcgtggcgtctg
gggctcggcgagtcgctcgtgcgggccgcggcgtacgcggcccgggtgggggcgtccgcc
gtcacccgctccggcgcccaggcgtcgttcccgacggcggaggaggtcgcggcgctgtga

DBGET integrated database retrieval system