KEGG   Streptomyces avermitilis: SAV_5329Help
Entry
SAV_5329          CDS       T00126                                 

Gene name
recD
Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sma  Streptomyces avermitilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAV_5329 (recD)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SAV_5329 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6456160..6458436
Genome map
AA seq 758 aa AA seqDB search
MASGASRAAQPGTGERHLAVLEGVLERITYANEENGYTVARVDTGRGAGDLLTVVGSLLG
AQVGESLRMEGRWGSHPQYGKQFTVENYTTVLPATVQGIRRYLGSGLVKGIGPVFADRIT
QHFGLDTLQIIEEEPKRLIEVPGLGPKRTKKITEAWEEQKAIKEVMLFLQTVEVSTSIAV
RIYKKYGDASISVVKNQPYRLATDVWGIGFLTADKIAQSVGIPHDSPERVKAGLQYALSQ
STDQGHCYLPEEQLIADAVKLLQVDTGLVIECLAELAAPSEEDGEPGVVRERLPGPDGGD
PVTAIYLVPFHRAELSLSAQLLRLLRTDQDRMPGFHDVAWDKALDWLKGRTGAELAPEQE
EAVRLALTQKVAVLTGGPGCGKSFTVRSIIELARAKRAKVVLAAPTGRAAKRLAELTGAE
ASTVHRLLELKPGGDAAYDKDRPLDADLVVVDEASMLDLLLANKLVKAVPPGAHLLFVGD
VDQLPSVGAGEVLRDLLADGGPIPAVRLTRVFRQAQQSGVVTNAHRINSGRHPLTDGMKD
FFLFVEDDTEEAGRLTVDVAARRIPAKFGLDPRRDVQVLAPMHRGPAGAGTLNGLLQQAV
TPARPDLPEKRFGGRVFRVGDKVTQIRNNYEKGENGVFNGTVGVVTSLDLDEQRLTVLTD
EDEEVAYEFDELDELAHAYAVTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVTRAKK
LVVLVGSRKAIGQAVRTVSAGRRCTALDFRLSPRPLAP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggccagtggggcgagtcgggcggcacagccaggtaccggagagcggcacctggccgtg
ctcgaaggcgtactggagcggatcacgtacgccaacgaggagaacggatacacggtcgcg
cgcgtggacaccggccgtggcgccggcgatctgctgaccgtcgtcggctcgctgctcggc
gcccaggtgggggagtcgctgaggatggagggccgttggggttcccatccccagtacggc
aagcagttcaccgtcgagaactacacgaccgtgctcccggccaccgtccagggcatccgc
cgctatctcggctccggcctcgtcaagggcatcggccccgtcttcgccgaccgcatcacc
cagcacttcggcctcgacaccctccagatcatcgaggaggagcccaagcggctgatcgag
gttcccgggctcggacccaagcggacgaagaagatcaccgaggcctgggaggagcagaag
gcgatcaaggaggtcatgctcttcctccagaccgtcgaggtgtcgacgtccatcgcggtc
cgcatctacaagaagtacggcgacgcctccatctccgtcgtcaagaaccagccctaccgc
ctcgccaccgacgtctggggcatcggcttcctcaccgccgacaagatcgcccagtccgtc
ggcatcccgcacgacagcccggagcgcgtcaaggccggtctccagtacgccctttcgcag
tccaccgaccagggccactgctacctccccgaggagcagctgatcgccgacgcggtgaag
ctgctccaggtggacacggggctggtcatcgagtgcctcgcggagctggcggcgccgagc
gaggaggacggcgagcccggcgtcgtacgggagcggctgcccggccccgacggaggggac
ccggtgacggccatctacctcgtccccttccaccgcgccgaactctccctctccgcccag
ctgttgcgcctcctgcgcaccgaccaggaccggatgcccggcttccacgacgtcgcctgg
gacaaggcgctcgactggctcaaggggcgtacgggggcggagctggcccccgagcaggag
gaggccgtccggctcgcgctcacccagaaggtcgcggtcctgaccggaggccccggctgc
ggcaagtcgttcacggtccgttcgatcatcgagctggcccgcgccaagcgggccaaggtc
gtgctcgccgcccccaccggccgcgccgccaaacgcctcgccgagctgaccggcgccgag
gcctccaccgtgcaccggctcctggagctgaagcccggcggcgacgcggcgtacgacaag
gaccgcccgctggacgccgacctggtggtcgtggacgaggcctccatgctcgacctcctc
ctcgccaacaagctggtcaaggcggtcccgccgggcgcccacctcctcttcgtcggcgat
gtcgaccagctgcccagcgtcggcgcgggcgaagtgctccgggacctcctcgcggacggc
ggccccatccccgccgtccgcctcacccgcgtcttccgccaggcccagcagtccggagtc
gtcaccaacgcgcaccgcatcaactccggccggcacccgctcaccgacgggatgaaggac
ttcttcctcttcgtcgaggacgacaccgaggaggccggccggctcacggtggacgtcgcg
gcccgtcgcattcccgccaagttcggcctcgatccgcggcgggacgtccaggtgctcgcc
cccatgcaccggggccccgccggcgcgggcacgctcaacggcctgctccagcaggcggtc
acccccgcccgcccggacctgcccgagaagcggttcggcggccgcgtcttccgcgtcggc
gacaaggtcacccagatccgcaacaattacgagaagggcgaaaacggtgtcttcaacggc
accgtgggcgttgtcacctccctcgacctggatgaacagcgcctgacggtgctgaccgac
gaggacgaggaggtggcgtacgagttcgacgaactcgacgagctggcgcacgcctacgcg
gtgaccatccaccgctcgcagggcagcgagtacccggccgtggtgatcccggtcaccacc
ggcgcctggatgatgctccagcgcaatctgctctacacagcggtgacccgcgccaagaag
ctggtcgtcctcgtcggttcgcgcaaggcgataggccaggcggtgcgcacggtatcggcc
ggacggcgttgcacggccctggacttcaggctttccccgcggcctctcgccccctga

DBGET integrated database retrieval system