KEGG   Streptomyces avermitilis: SAV_5335Help
Entry
SAV_5335          CDS       T00126                                 

Definition
oxidoreductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAV_5335
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_5335
  Lipid metabolism
   00071 Fatty acid degradation
    SAV_5335
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAV_5335
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAV_5335
   00626 Naphthalene degradation
    SAV_5335
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAV_5335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6466793..6467836
Genome map
AA seq 347 aa AA seqDB search
MRAVVFERFGEPAEVREVADPEPSEHGVVVRVEATGLCRSDWHGWVGHDPDITLPHVPGH
ELAGVVEAVGTRVSGWRPGDRVTVPFVCACGSCAACAAGDQQVCERQAQPGFTHWGSFAQ
YVALEHADVNLVAMPDELSFGTAAALGCRFATAFRAVVAQGRVAAGEWVAVHGCGGVGLS
AVMIAAASGARVVAVDVSPQALDLARKFGAAASVDASRVEDTAAAVRELTGGGAHLSLDA
LGSPVTCVASVNGLRRRGRHVQVGLLPSSTGSTPVPMARVIGLELEVLGSHGMAAHAYPP
MLELVRAGVLRPDLLVTSAIPLDTAPIALAAMGTAPGAGVTVIEPWR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggtggtgttcgagcggttcggggagccggccgaggtgcgggaggtggcggat
ccggagccctcggagcacggggtcgtggtgcgggtcgaggcgaccgggttgtgccggagc
gactggcacgggtgggtggggcacgacccggacatcacgctgccgcatgtgccggggcac
gaactcgcgggcgtggtcgaggcggtgggcacccgggtgagcgggtggcggcccggcgac
cgggtcaccgtaccgttcgtctgcgcctgcggaagctgcgccgcgtgcgcggcgggcgat
cagcaggtgtgcgagcggcaggcccagccgggattcacgcactggggctccttcgcgcag
tacgtggcgctggagcacgcggacgtgaacctggtcgcgatgccggacgagctgtcgttc
gggacggcggcggcgctgggctgccggttcgccacggcgttccgggcggtggtggcgcag
ggcagggtggcggcgggggagtgggtcgccgtgcacggctgcggcggcgtcggactgtcg
gcggtgatgatcgcggcggcctccggcgcccgcgtcgtcgccgtcgacgtctcgccccaa
gccctcgacctggcacggaagttcggcgcggccgcgagtgtggacgcctcgcgcgtcgag
gacacggcggcggcggtccgtgagctgaccggcggcggcgcccatctctccctcgacgcg
ctcggctcacccgtcacctgcgtggcttcggtgaacgggctgcgccgccgcggccggcac
gtccaggtgggcctgctgccctcgtccaccggctccaccccggtccccatggcccgggtg
atcggcctcgaactcgaggtcctcggcagccacggcatggcggcgcacgcctacccgccg
atgctggagctggtgcgcgcgggggtgctgcgccccgacctcctggtcacctcggcgatc
ccgctggacacggccccgatagcgctggcggccatggggacggccccgggggcgggggtg
acggtcatcgaaccgtggcgctga

DBGET integrated database retrieval system