KEGG   Streptomyces avermitilis: SAV_5362Help
Entry
SAV_5362          CDS       T00126                                 

Gene name
melC1-2
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
sma  Streptomyces avermitilis
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAV_5362 (melC1-2)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAV_5362 (melC1-2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SAV_5362 (melC1-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6500482..6501345
Genome map
AA seq 287 aa AA seqDB search
MYTRKDVSTLTRSERRRLVAALLEVKRRGEYDEFVRMHIKYYVADGETGLRAAHMAPSFL
PWHRMFLLDLERVLRRVDESVTMPYWDWTRSRSRTAAPWTEDLLGGTGRQSDRQVTTGPF
AYRHGGWPIKEGITDAEYLMRDLGRSRDPIALPTARDLQGALDDPVYDTAPWNSTSAKGF
RNRLEGWGPGRGAASWRNHNRVHRWVGGHMVSGASVNDPVFWMHHAFVDLLWSRWQQRHQ
GARYLPEQQPARGDAQRGRIVARHERMPPWDVTPDQLEDHSGIYRYA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgtacacgcgtaaggacgtcagcacgctcacccggtccgagcggcgtcggctcgtcgcc
gcactgctcgaggtcaaacgccgcggcgagtacgacgagttcgtgcgcatgcacatcaag
tactacgttgccgacggcgagaccggcctgcgcgccgcccacatggcaccctccttcctg
ccctggcaccgcatgtttctgctggacctggagcgggtgctgcgccgggtggacgagtcg
gtgaccatgccgtactgggactggacgcgcagccgcagccggacggccgcaccgtggacc
gaggacctgctcggcggcaccgggcggcaatccgaccgccaggtcaccaccggccccttc
gcctaccgtcacggtgggtggcccatcaaggaggggatcaccgacgccgagtacctcatg
cgtgacctgggccgctcccgggacccgatcgcgctgccgacggccagggatctgcagggc
gccctcgacgatcccgtctacgacacggccccgtggaactccacgtccgccaaaggattc
cgcaacaggctggaggggtggggtccggggcggggagccgcttcgtggcgcaaccacaac
cgggtccaccgttgggtcggcggccacatggtgagcggcgcctccgtcaacgaccccgtc
ttctggatgcaccacgccttcgtcgacctcctctggtcccgctggcagcagaggcaccag
ggcgcccgctatctccccgagcagcagcccgcccggggcgacgcccagcgtggccgcatc
gtcgcgcggcacgagaggatgccgccgtgggacgtgacaccggaccagctggaggatcac
agcgggatctaccggtacgcgtag

DBGET integrated database retrieval system