KEGG   Streptomyces avermitilis: SAV_5391Help
Entry
SAV_5391          CDS       T00126                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sma  Streptomyces avermitilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAV_5391 (malQ)
Enzymes [BR:sma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SAV_5391 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6536171..6538393
Genome map
AA seq 740 aa AA seqDB search
MPPAETGESETDEPGEADRAHAADGIHGADETDGAHEAHGVGEAPLARLAALHGVATSYS
PSPGRTVAASDAAVTTALAALGVDAGTPDAVHRALAARETELRRRLLPPTVVCWGEQPPA
ALTDLPDGTRLRIETEQGETRASAEQLPPGVHALHITAPDGRSADAHLVVAPARLSAPPG
RAYGLLVQLYSLLSQRSWGMGDLGDLAELAAWAGRALGAGFVQLNPLHVAVPGDPTDPSP
YRPSSRRYPDPVHLRVEDVPEFAYVDDPGPVRTLLDRAARLRESVLRKGALIDRDAVWEL
KREALERVHAVPLGPGRRAAYVDFLAEEGEALEDHATWCALAEVYGADGHGWPAGLRDPR
SAETARARGELMDRVDFHAWLAWLTDEQLAAAQRAARDAGMAVGLVHDLAVGVHPVGADA
WAQQEYFAAGMSVGAPPDAFNALGQDWGLPPWRPDRLAESGYAPYRRLLRALFRYAGALR
IDHVMGLFRLWWVPQGRPPTEGTYVRYDAEAMLAILVLEASRTGALVIGEDLGTVEPGVR
ETLHARGVLGTSVLWFERDWEGDGLPLPPERWRADCLATATTHDLPPTAARLTGAHVELR
DRLGLLARPLEEERAAAAADTAEWLALLARLGLLKGASGGICSVSEEAEIQAVHAFLLRT
PARLVGLWLPDAVGDRRPQNLPGTWDQYPNWRLPIADARGRPVTLEELAAAPRLHALVDV
LRGLPAGGGAPGGARCGERG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggccgagacgggtgagagcgagacggacgaacccggtgaggccgaccgggct
catgcggccgacgggatccatggcgccgacgagaccgatggggcccacgaggcccacggt
gtcggtgaggcgccgctggcgcggctcgccgcgctccatggcgttgccacctcctacagc
ccctccccgggccggacggtcgccgcttcggacgccgccgtcaccacggccctcgccgcg
ctcggcgtcgacgcgggcaccccggacgccgtacaccgtgccctcgcggcgcgcgagacg
gagctgcgccggcggctgctgccgccgaccgtcgtgtgctggggcgaacagccgcccgcc
gcgctgaccgacctgccggacggcacccgcctgcgcatcgagaccgaacagggcgagacc
cgcgcctcggccgagcagctcccgcccggtgtccacgcgttacacatcaccgcaccggac
ggccgcagcgccgacgcccatctcgtcgtcgcgcccgcccggctgtccgcgccgcccgga
cgcgcctacggactcctcgtccagctctactccctcctctcccagcgctcctggggcatg
ggcgacctcggtgacctcgccgagctggccgcctgggcgggccgggcgctcggcgccgga
ttcgtgcagctcaacccgttgcacgtggccgtgccgggcgaccccaccgacccgtccccg
taccgcccctcctcccgccgctaccccgacccggtgcacctgcgtgtcgaggacgttccc
gagttcgcgtacgtcgacgaccccggtccggtccgtacgctcctcgaccgcgccgcccgg
ctgcgcgaatccgtcctgcgaaagggcgcgttgatcgaccgcgacgccgtatgggagctg
aagcgggaggcgctggaacgcgtgcacgccgtgcccctcggacccggacggcgcgccgcc
tacgtcgacttcctcgccgaggagggcgaggcgctggaggaccacgcgacgtggtgcgcg
ctggccgaggtgtacggggccgatgggcacggctggccggccgggctgcgcgacccgcgc
tcggccgagaccgcccgggcgcgcggcgagttgatggaccgcgtcgacttccacgcctgg
ctcgcctggctgaccgacgagcagctcgccgccgctcagcgggccgcgcgtgacgcgggc
atggcggtcggactcgtgcacgacctcgcggtcggcgtccatcccgtcggcgccgacgcc
tgggcgcagcaggagtacttcgccgcgggcatgtcggtgggcgccccgcccgacgccttc
aacgcgctcggccaggactggggcctgccgccctggcgaccggaccgcctcgccgagtcc
ggctacgccccgtaccgccgtctgctccgcgccctcttccgatacgcgggcgccctgcgc
atcgaccacgtgatggggctgttccggctgtggtgggtgccgcaggggcggccgcccacg
gagggaacgtacgtccggtacgacgccgaggcgatgctcgcgatcctcgtcctggaggca
tcgcgcaccggggcactggtgatcggcgaggacctcggcacggtcgaacccggggtgcgc
gagacgctgcacgcgcgcggcgtgctcggcacgtcggtgctgtggttcgaacgggactgg
gagggggacgggctgccgctgccgcccgagcgctggcgcgcggactgcctggccaccgcc
accacccacgacctgccgccgaccgccgcccggctcaccggcgcgcacgtcgaactccgc
gaccgtctcggcctgttggcccggccgctggaggaggagcgggccgcggcggcggcggac
acggcggaatggctggccctgctggcccggctcggactgctcaagggtgcgagcgggggc
atctgctcggtgtccgaggaggccgagatccaggccgtgcacgcctttctgctgcgcacc
ccggcccggctggtcggcctgtggctgccggacgcggtgggcgaccggcgcccgcagaac
ctgccgggtacgtgggaccagtatccgaactggcgtctgccgatcgccgatgcgcggggc
cgtccggtgacgctggaggagctggcggccgcgccgcggttgcacgcgttggtggatgtg
ctgcggggccttccggcggggggcggggcgccgggcggcgcgaggtgcggggagcggggc
tga

DBGET integrated database retrieval system