KEGG   Streptomyces avermitilis: SAV_575Help
Entry
SAV_575           CDS       T00126                                 

Gene name
cyp2
Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sma  Streptomyces avermitilis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SAV_575 (cyp2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SAV_575 (cyp2)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAV_575 (cyp2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SAV_575 (cyp2)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SAV_575 (cyp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(726776..729997)
Genome map
AA seq 1073 aa AA seqDB search
MTTQPETDLRPIRSPRGVPLFGHTPQIPSTNPVEYFGKLSKQFPEGLYGMEIAGIEQVFV
WDPDLVAEVCDETRFFKQIDKTPLAHVRDYAGAGLFTAHQHEEEWGMAHRVLLPVFSQRA
MKGYFGQMLEIAQNLVGKWERKEGQPVNITDDYTRLTLDTIALSGFGYRFDSFAKEDLHP
FLNALLQALVESLRRSQELPVMTKMRKADDKKYRENIRLMRDLVENVIKERREGKGTGED
DLLGLMLEATDPETGKGLDDDNVRDQVVTFLIAGHETTSGLLSFATYSLMRNPHILAQAY
AEVDRLLPGDTVPDYDTIMQMDVIPRILEETLRLWAPIPMIGKSPLEDTVIGGCYGLKKG
ARVNILEGPLHTHPKAWERPEEFDINRWLPENRVNHHPHAYKPFGNGVRACIGRQFALTE
ARLALALVLQKFKFADTDDYKMDVKEALTRKPGGFELNVRARQEHERTVFGAADLQTDDT
QAQAAVSGVGVNLTVAYGSSLGSCEDLARTIADRGERSGFGTTLVGLDELGDNLPTEGLL
VVVASSYNGKAPDNAQRFDDLLAAGLPEGSLSNVRFALLGAGNTQWVATYQGFPKRIEAG
LLAAGATRVIERGIADAAGDFDGMATRWMDTLWTTLAEEYAADTSETTGPRFEVQLLTEA
EVRPAIVSEQAYPLTVVANEELVSDATGLWDFSIEPPRPAAKSITIELPDGVTYDTGNHL
AVFAKNEPVLVNRALARLGVDRDQVLRLDQPGGGRTHLPVGTPVTTGLLFTEFVELQDVA
TRSQIQELAEHTQCPWTRPQLQAYTADTAEAEERYQKEILGKRVSVLNLLERFPAVELPL
AVFLEMMGPIRPRFYSISSSPLANPRHVRLTVGLLEGPALSGDGRYRGTCSSYIAGLESG
DVFYGYVRVPSPTFAPPADPATPLLLIGPGTGIAPLRGFLEERAHQHAHGTQVGLSQVFV
GCRHPEHDYFYRQEMQDWEQAGIAQVHTAFSAVTGHPARFVQDAIVGAADTVWQAIQDGA
YVYVCGDGRRMAPAVREALAAIYRKHTGSDDEAAQQWLAQLEADERYQQDVFA
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacagcccgagaccgacctgcggcccatccggtctccgcggggcgtcccgctc
ttcggccacacgccgcagatccccagcaccaacccggtggagtacttcggcaagctgtcc
aagcagttccccgaggggctctacggcatggagatcgccggcatcgagcaggtcttcgtc
tgggacccggacctggtggccgaggtctgcgacgagacgcggttcttcaagcagatcgac
aagacgccgctggcccatgtccgggactacgcgggagccggcctgttcacggcccaccag
cacgaagaggaatggggcatggcgcaccgagtcctcctcccggtcttcagccagcgggcg
atgaagggctacttcgggcagatgctggagatcgcccagaacctggtgggcaagtgggag
cgtaaggagggccagcccgtcaacatcaccgacgactacacccggctgaccctggacacc
atcgccctgtcgggtttcggttaccggttcgactccttcgccaaggaggatctgcacccc
ttcctcaacgcgctgctgcaggcgctggttgagtcgctgcggcgctcgcaggagctgccg
gtgatgaccaagatgcgcaaggccgatgacaagaagtaccgcgagaacatccggctgatg
cgggacctggtcgagaatgtgatcaaggagcgccgtgaggggaagggcacaggtgaggac
gacctgctgggcctgatgctggaggccacggacccggagaccggcaaggggctggacgac
gacaacgtccgtgaccaggtggtgacgttcctgatcgccggtcacgagaccaccagtggt
ctgctgtcgttcgccacgtactcgctgatgcgcaacccgcacatcctggcccaggcctac
gccgaggtggaccgactgctgccgggtgacacggtcccggactacgacacgatcatgcag
atggacgtgatcccgcggatcctggaggagaccctgcgcctgtgggctcccatcccgatg
atcggcaagtccccgctggaggacaccgtcatcggtggctgctacgggctgaagaaggga
gcgcgggtcaacatcctcgagggtccgctgcacacccaccccaaggcgtgggagcggccg
gaggagttcgacatcaaccggtggctgccggagaaccgggtcaaccaccacccgcacgcc
tacaagccgttcggcaacggtgtgcgtgcctgcatcggccggcagttcgcactcaccgag
gcgcgtctggccctcgcgctggttctgcagaagttcaagttcgccgacaccgacgactac
aagatggacgtcaaggaggcgctgacgcgcaagcccggcggcttcgaactgaacgtgcgg
gctcgtcaggagcacgagcggaccgtgttcggcgccgcggacctgcagaccgacgacacg
caggcgcaggccgcggtcagcggtgtcggggtgaacctgaccgtcgcctacggctccagc
ctgggctcgtgcgaggacctggcgcgcaccatcgccgaccgcggtgagcgctccggattc
ggcaccaccctggtcggcctggacgagttgggtgacaacctgcccaccgagggcctgctc
gtcgtcgtggcctccagctacaacggcaaggccccggacaacgcgcagcgcttcgacgac
ctgctcgccgccggactcccggagggctcgctgtccaacgtgcggttcgcgctgctgggt
gccggcaacacgcagtgggtggccacctaccagggcttccccaagcggatcgaggcaggc
ctgctggccgccggcgccacccgcgtcatcgagcgcggtatcgcggacgccgccggtgac
ttcgacggcatggccacccgctggatggacaccctgtggaccaccctggccgaggagtac
gccgccgacacctccgaaaccaccgggccgcgcttcgaggtgcagctgctgaccgaggcg
gaggtgcgtcccgcgatcgtctcggagcaggcctaccccctcaccgtggtcgccaacgag
gagctggtcagcgacgcgaccgggctgtgggacttcagcatcgagccgccgcgcccggcc
gcgaagtccatcaccatcgaactccccgacggtgtcacctatgacaccggcaaccacctg
gccgtcttcgccaagaacgagcccgtgctggtcaaccgcgccctcgcgcggctcggcgtc
gaccgcgaccaggtgctccggctcgaccagcccggcggtggccggacccacctcccggtg
ggcacccccgtcaccacaggcctgctgttcaccgagttcgtcgagctgcaggacgtggcc
acccgatctcagatacaggagctggccgagcacacccagtgcccgtggacccggccgcag
ctgcaggcctacacggccgacaccgccgaagccgaggagcgctaccagaaggagatcctg
ggcaagcgggtctccgtactcaacctgctggagcgcttcccggcggtcgaactgccgctg
gcggtcttcctggagatgatgggcccgatccgcccgcggttctactccatctcctcctcc
ccgctggccaacccgcgccacgtccggctgaccgtcggtctgctggaaggcccggccctg
tccggcgacggccggtaccgcggcacctgctcctcctacatcgcaggcctcgagtccggt
gacgtcttctacggctacgtgcgcgtgccctccccgacgttcgccccgccggccgacccc
gccacgccgctgctcctcatcggccccggcaccggcatcgcgccgctgcgcggcttcctg
gaggagcgtgcccaccagcacgcgcacggcacccaggtgggcctgtcccaggtcttcgtc
ggctgccgccacccggagcacgactacttctaccggcaggagatgcaggactgggagcag
gccgggatcgcccaggtgcacaccgccttctccgcggtgaccggacacccggcccggttc
gtccaggacgccattgtgggtgccgccgacaccgtgtggcaggccatccaggacggcgcg
tacgtctacgtctgcggtgacggccgccgcatggcacccgccgtgcgcgaggcgctcgcc
gccatctaccgaaagcacaccggcagcgacgacgaggccgcccagcagtggctcgcccag
ctggaagcggacgagcgctaccagcaggacgtcttcgcctga

DBGET integrated database retrieval system